DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17197 and ZDHHC18

DIOPT Version :9

Sequence 1:NP_651425.2 Gene:CG17197 / 43111 FlyBaseID:FBgn0039367 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_115659.1 Gene:ZDHHC18 / 84243 HGNCID:20712 Length:388 Species:Homo sapiens


Alignment Length:233 Identity:57/233 - (24%)
Similarity:94/233 - (40%) Gaps:65/233 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 TAVLFVIVTTIFFVVLQMFYVVPQLFDVQGFMYKLGWLVAIFITYNIFGNMLACHI--------- 81
            |.:|.:..|.:|||           ||......||...:.| |...:|..:::|.:         
Human    97 TLLLILTTTGLFFV-----------FDCPYLARKLTLAIPI-IAAILFFFVMSCLLQTSFTDPGI 149

  Fly    82 --TSTSVESLPKDRQI---------PEPEEEH--------QWHYCDVCEKLMPPRSWHCILCKCC 127
              .:|..|:...::||         |.|....        :..||..|:...|||:.||.:|..|
Human   150 LPRATVCEAAALEKQIDNTGSSTYRPPPRTREVLINGQMVKLKYCFTCKMFRPPRTSHCSVCDNC 214

  Fly   128 ILKRDRHCIFTASCVGHNNQRYFFWFTLFMALGTGVALA---THI---------IATLKYFSYSD 180
            :.:.|.||.:..:|||..|.|:|:.|.|.::..|....|   ||:         ::|||....|.
Human   215 VERFDHHCPWVGNCVGRRNYRFFYAFILSLSFLTAFIFACVVTHLTLRAQGSNFLSTLKETPASV 279

  Fly   181 L----IFLNIPRDNLPPFWLVITLI-LNTYVFAAPVSS 213
            |    .|.:|        |.::.|. .:||:.|:.:::
Human   280 LELVICFFSI--------WSILGLSGFHTYLVASNLTT 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17197NP_651425.2 PHA02688 <9..70 CDD:222919 12/43 (28%)
zf-DHHC 100..>198 CDD:279823 33/121 (27%)
ZDHHC18NP_115659.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..67
zf-DHHC 191..314 CDD:279823 37/127 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 364..388
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.