DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17197 and AT5G05070

DIOPT Version :9

Sequence 1:NP_651425.2 Gene:CG17197 / 43111 FlyBaseID:FBgn0039367 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_196126.2 Gene:AT5G05070 / 830389 AraportID:AT5G05070 Length:413 Species:Arabidopsis thaliana


Alignment Length:161 Identity:40/161 - (24%)
Similarity:67/161 - (41%) Gaps:32/161 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 YCDVCEKLMPPRSWHCILCKCCILKRDRHCIFTASCVGHNNQRYFFWFTLFMALGTGVALATHII 170
            :||.|....|||:.||.:|..|:.:.|.||.:...|:...|..:|..|     :.:...|..::.
plant   172 FCDTCLLYRPPRASHCSICNNCVQRFDHHCPWVGQCIARRNYPFFICF-----ISSSTLLCIYVF 231

  Fly   171 ATLKYFSYSDLIFLNIPRDNLP-PFWL-----VITLILNTYVFAAP--VSSV-LMQLSVLKNNGT 226
            .    ||:.:||       ..| ..|.     ::::||..|.|.|.  |..: :....::..|.|
plant   232 V----FSWINLI-------RQPGKLWRTMSDDIVSVILIVYTFVAVWFVGGLTIFHFYLMSTNQT 285

  Fly   227 LHKFYSDTYD-------LGLWENFKLILGGK 250
            .::.:...||       .||.:|.|.:|..|
plant   286 TYENFRYRYDKKENPYKRGLLKNVKEVLFAK 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17197NP_651425.2 PHA02688 <9..70 CDD:222919
zf-DHHC 100..>198 CDD:279823 24/97 (25%)
AT5G05070NP_196126.2 zf-DHHC 171..292 CDD:279823 32/135 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.