DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17197 and AT4G24630

DIOPT Version :9

Sequence 1:NP_651425.2 Gene:CG17197 / 43111 FlyBaseID:FBgn0039367 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_194194.2 Gene:AT4G24630 / 828565 AraportID:AT4G24630 Length:407 Species:Arabidopsis thaliana


Alignment Length:226 Identity:51/226 - (22%)
Similarity:85/226 - (37%) Gaps:59/226 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SHPTAVLFVIVTTIFFVVLQMFYVVPQLFDVQGFMYKLGW-LVAIFITYNIFGNMLACHITSTSV 86
            |.|..:|.:||..:.|.|.     |.:....:...|..|: ::.:.|.:.|:..:|....::...
plant    29 SLPLTLLLIIVPVVLFCVF-----VARHLRHEFSPYNAGYAIMVVAILFTIYVLILLFFTSARDP 88

  Fly    87 ESLPKDRQIPEPEEEHQW-----------------------------HYCDVCEKLMPPRSWHCI 122
            ..:|::...||.:..::.                             .|||.|....|||..||.
plant    89 GIVPRNSHPPEEDLRYETTVSADGRQTPSVQIPRTKEVIVNGVSVRVKYCDTCMLYRPPRCSHCS 153

  Fly   123 LCKCCILKRDRHCIFTASCVGHNNQRYFFWFTLFMALGTGVALATHIIATLKYFSYSDLIFLNIP 187
            :|..|:.:.|.||.:...|:|..|.||||.|     :.:...|..:|      ||.| .:::.|.
plant   154 ICNNCVERFDHHCPWVGQCIGLRNYRYFFMF-----VSSSTLLCIYI------FSMS-AVYIKIL 206

  Fly   188 RDNLPPF---------WLVITLILNTYVFAA 209
            .|:....         |.|:.:|   |.|.|
plant   207 MDHQQATVWRAMKESPWAVVLMI---YCFIA 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17197NP_651425.2 PHA02688 <9..70 CDD:222919 11/47 (23%)
zf-DHHC 100..>198 CDD:279823 30/135 (22%)
AT4G24630NP_194194.2 zf-DHHC 136..261 CDD:279823 35/114 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.