DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17197 and AT3G56920

DIOPT Version :9

Sequence 1:NP_651425.2 Gene:CG17197 / 43111 FlyBaseID:FBgn0039367 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_191251.2 Gene:AT3G56920 / 824859 AraportID:AT3G56920 Length:338 Species:Arabidopsis thaliana


Alignment Length:260 Identity:56/260 - (21%)
Similarity:97/260 - (37%) Gaps:74/260 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 LQMFYVVPQLFDVQGFMYKLGWLVAIFITYNIFGNMLACHITSTSVES-LPKDRQIPEPE----- 99
            ::|.|::...   ..|.:.|..:.||.:|:..|..:.   :||:.... :|:::|:.|.|     
plant    52 IRMAYLISHR---HPFFHSLTLIGAILLTFMAFTFLF---LTSSRDPGIIPRNKQVSEAEIPDVT 110

  Fly   100 -EEHQW-------------------------HYCDVCEKLMPPRSWHCILCKCCILKRDRHCIFT 138
             :..:|                         .:||.|:...|||::||.:|..|:.:.|.||.:.
plant   111 TQSTEWVTSKLGSVKLPRTKDVMVNGFTVKVKFCDTCQLYRPPRAFHCSICNNCVQRFDHHCPWV 175

  Fly   139 ASCVGHNNQRYFFWFTLFMALGTGVALATHIIATLKYFSYSDLI-----FLNIPRDNLPPFWLVI 198
            ..|:...|..:|..|     |.....|..::..    ||:..::     |..:..|:|      |
plant   176 GQCIALRNYPFFVCF-----LSCSTLLCIYVFV----FSWVSMLKVHGEFYVVLADDL------I 225

  Fly   199 TLILNTYVFAAPVS-------SVLMQLSVLKNNGTLHKF------YSDTYDLGLWENFKLILGGK 250
            ..:|..|.|   ||       :|.....:..|..|...|      ..:.|..|:.||||.:...|
plant   226 LGVLGLYCF---VSVWFVGGLTVFHFYLICTNQTTCENFRYHYDKKENPYRKGILENFKELFFAK 287

  Fly   251  250
            plant   288  287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17197NP_651425.2 PHA02688 <9..70 CDD:222919 6/28 (21%)
zf-DHHC 100..>198 CDD:279823 25/127 (20%)
AT3G56920NP_191251.2 zf-DHHC 142..263 CDD:279823 34/138 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.