DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17197 and AT3G48760

DIOPT Version :9

Sequence 1:NP_651425.2 Gene:CG17197 / 43111 FlyBaseID:FBgn0039367 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_190445.2 Gene:AT3G48760 / 824037 AraportID:AT3G48760 Length:476 Species:Arabidopsis thaliana


Alignment Length:260 Identity:61/260 - (23%)
Similarity:99/260 - (38%) Gaps:61/260 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 IVTTIFFV---VLQMFYVVPQLFDVQGFMYKLGWLVAIFITYNIFGNMLACHITSTSVES-LPKD 92
            |:.|:|.:   |:.....|.:.| :..|.:..|..|.......|..:::...:||..... :|::
plant    54 ILITVFLITAPVIVFCIFVGRKF-IDDFPHHRGVSVLAVAVGLILLDLVFLLLTSARDPGIIPRN 117

  Fly    93 RQIPEPE------EEHQWH----------------------YCDVCEKLMPPRSWHCILCKCCIL 129
            ...||||      |....|                      |||.|....|||:.||.:|..|:.
plant   118 LYPPEPESNEGNGEPRLAHTPQSRLPRTKDMIVNGITVKIKYCDTCMLYRPPRASHCSICNNCVE 182

  Fly   130 KRDRHCIFTASCVGHNNQRYFFWFTLFMALGTGVALATHIIATL--KYFSYSDLI-----FLNIP 187
            |.|.||.:...|:|..|.|::|.|.|...|   :.:..|:...:  |....|:.|     ||..|
plant   183 KFDHHCPWLGQCIGLRNYRFYFMFVLCSTL---LCIYVHVFCWIYVKRIMDSENINIWKSFLKTP 244

  Fly   188 RDNLPPFWLVITLILNTYV---FAAPVSSVLMQLSVLKNNGTLHKF------YSDTYDLGLWENF 243
            ..        |.||:.|::   |...::...:.| :..|..|...|      :.:.::.|:..||
plant   245 AS--------IALIIYTFICVWFVGGLTCFHLYL-MSTNQSTYENFRYRYDRHENPFNKGIVGNF 300

  Fly   244  243
            plant   301  300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17197NP_651425.2 PHA02688 <9..70 CDD:222919 9/40 (23%)
zf-DHHC 100..>198 CDD:279823 32/126 (25%)
AT3G48760NP_190445.2 zf-DHHC 153..283 CDD:279823 39/141 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.