DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17197 and AT2G40990

DIOPT Version :9

Sequence 1:NP_651425.2 Gene:CG17197 / 43111 FlyBaseID:FBgn0039367 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_181632.5 Gene:AT2G40990 / 818699 AraportID:AT2G40990 Length:411 Species:Arabidopsis thaliana


Alignment Length:258 Identity:49/258 - (18%)
Similarity:94/258 - (36%) Gaps:85/258 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 LQMFYVVPQLFDVQGFMYKLGWLVAIFITYNIFGNMLACHITSTSVES-LPKDRQIPEPE----- 99
            ::|.:::.:.:.:...:..||.|:...:.:...      .:||:.... :|::::.||.|     
plant    70 IRMVFLIGKRYPLFHSLILLGALLLTVLDFTFL------FLTSSRDPGIIPRNKEAPEAEGLDMI 128

  Fly   100 -EEHQW-------------------------HYCDVCEKLMPPRSWHCILCKCCILKRDRHCIFT 138
             :..:|                         .:||.|....|||:.||.:|..|:.:.|.||.:.
plant   129 TQSSEWVNNKLGNTKIPRTKDILVNGYTVKVKFCDTCLLYRPPRASHCSICNNCVQRFDHHCPWV 193

  Fly   139 ASCVGHNNQRYFFWFTLFMALGTGVALATHIIATLKYFSY----------------SDLIFLNIP 187
            ..|:...|..||..|     :.|...|..::..    ||:                :||:|    
plant   194 GQCIALRNYPYFICF-----ISTSTLLCLYVFV----FSWVSMLEVHGKMLLMVITNDLVF---- 245

  Fly   188 RDNLPPFWLVITLILNTYVFAAPVSSV-LMQLSVLKNNGTLHKFYSDTYD-------LGLWEN 242
                      :.|||..:|....|..: :..|.::..|.|.::.:...||       .||::|
plant   246 ----------VVLILYCFVVVWFVGGLTVFHLYLICTNQTTYENFRYRYDKKENPYGKGLFKN 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17197NP_651425.2 PHA02688 <9..70 CDD:222919 4/28 (14%)
zf-DHHC 100..>198 CDD:279823 26/138 (19%)
AT2G40990NP_181632.5 DHHC 160..282 CDD:396215 33/144 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.