DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17197 and ZDHHC14

DIOPT Version :9

Sequence 1:NP_651425.2 Gene:CG17197 / 43111 FlyBaseID:FBgn0039367 Length:290 Species:Drosophila melanogaster
Sequence 2:XP_016866796.1 Gene:ZDHHC14 / 79683 HGNCID:20341 Length:506 Species:Homo sapiens


Alignment Length:316 Identity:68/316 - (21%)
Similarity:110/316 - (34%) Gaps:118/316 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WAC----TKYLA----RRNPKIFVRISHPTAVLFVIVTTIFFVVLQMFYVVPQLFDVQGFMYKLG 61
            |:|    :.:||    |..|.:.|:|   |..:..:...:||.|:                    
Human    83 WSCLPTISSWLAGCLLRSCPYLAVKI---TPAIPAVAGILFFFVM-------------------- 124

  Fly    62 WLVAIFITYNIFGNMLACHITSTSV-------ESLPKDRQI------------PEPEEEH----- 102
                        |.:|....:...|       |:...:|||            |.|..:.     
Human   125 ------------GTLLRTSFSDPGVLPRATPDEAADLERQIDIANGTSSGGYRPPPRTKEVIING 177

  Fly   103 ---QWHYCDVCEKLMPPRSWHCILCKCCILKRDRHCIFTASCVGHNNQRYFFWFTLFMALGTGVA 164
               :..||..|:...|||:.||.||..|:.:.|.||.:..:|||..|.|:|:.|.|.::..|...
Human   178 QTVKLKYCFTCKIFRPPRASHCSLCDNCVERFDHHCPWVGNCVGKRNYRFFYMFILSLSFLTVFI 242

  Fly   165 LA---THIIATLKYFSYSDLIFLNIPRDNLPPFWLVITLILNTYVFAAPVSSVLMQLSVLKNNGT 226
            .|   ||:|...:...     |||..:|:  |              |:.:.:|:...||      
Human   243 FAFVITHVILRSQQTG-----FLNALKDS--P--------------ASVLEAVVCFFSV------ 280

  Fly   227 LHKFYSDTYDLGLWENFKLILGGKGFWTFLSPTVKSPLPHDGAQWKIKR-VQHHSP 281
                         |.    |:|..||.|:|..:.::........|..|| .::::|
Human   281 -------------WS----IVGLSGFHTYLISSNQTTNEDIKGSWSNKRGKENYNP 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17197NP_651425.2 PHA02688 <9..70 CDD:222919 10/64 (16%)
zf-DHHC 100..>198 CDD:279823 32/108 (30%)
ZDHHC14XP_016866796.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.