Sequence 1: | NP_651425.2 | Gene: | CG17197 / 43111 | FlyBaseID: | FBgn0039367 | Length: | 290 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001071249.1 | Gene: | zdhhc15b / 777734 | ZFINID: | ZDB-GENE-061110-106 | Length: | 332 | Species: | Danio rerio |
Alignment Length: | 205 | Identity: | 58/205 - (28%) |
---|---|---|---|
Similarity: | 88/205 - (42%) | Gaps: | 50/205 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 106 YCDVCEKLMPPRSWHCILCKCCILKRDRHCIFTASCVGHNNQRYFFWFTLFMALGTGVALATHII 170
Fly 171 ATLKYFSYSDLIFLNIPRDNLP----PFWLVITLILNTYVFAAPVSSVLMQL------SVLKNNG 225
Fly 226 TLHKFY---------SDTYDLGLWENFKLILG-GKGFWTFLSPTVKSPLPHDGAQWKIKRVQHHS 280
Fly 281 PKLQFLRVSD 290 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17197 | NP_651425.2 | PHA02688 | <9..70 | CDD:222919 | |
zf-DHHC | 100..>198 | CDD:279823 | 30/95 (32%) | ||
zdhhc15b | NP_001071249.1 | zf-DHHC | 16..292 | CDD:303066 | 54/197 (27%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 305..332 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5273 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |