DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17197 and zdhhc15b

DIOPT Version :9

Sequence 1:NP_651425.2 Gene:CG17197 / 43111 FlyBaseID:FBgn0039367 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001071249.1 Gene:zdhhc15b / 777734 ZFINID:ZDB-GENE-061110-106 Length:332 Species:Danio rerio


Alignment Length:205 Identity:58/205 - (28%)
Similarity:88/205 - (42%) Gaps:50/205 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 YCDVCEKLMPPRSWHCILCKCCILKRDRHCIFTASCVGHNNQRYFFWFTLFMALGTGVALATHII 170
            :||.|:.:.|.|..||.:|:.|:||.|.||.:..:|||.:|.::|..|     |...:.....|.
Zfish   124 FCDRCQVIKPDRCHHCSVCETCVLKMDHHCPWVNNCVGFSNYKFFLLF-----LSYSMIYCVFIA 183

  Fly   171 ATLKYFSYSDLIFLNIPRDNLP----PFWLVITLILNTYVFAAPVSSVLMQL------SVLKNNG 225
            :|:  |.|    ||.....:||    .|.::..|.:....|.:     ||.|      .|.||..
Zfish   184 STV--FQY----FLKFWVGDLPNGPAKFHVLFLLFVALMFFVS-----LMFLFGYHCWLVAKNRS 237

  Fly   226 TLHKFY---------SDTYDLGLWENFKLILG-GKGFWTFLSPTVKSPLPHDGAQWKIKRVQHHS 280
            ||..|.         .:.:::||.:|.:.:.| .|..| |: |...|  ..||         |:.
Zfish   238 TLEAFSPPVFQNGPDRNGFNVGLNKNLRQVFGEHKKLW-FI-PVFTS--QGDG---------HYF 289

  Fly   281 PKLQFLRVSD 290
            | |:.||.|:
Zfish   290 P-LRTLRESE 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17197NP_651425.2 PHA02688 <9..70 CDD:222919
zf-DHHC 100..>198 CDD:279823 30/95 (32%)
zdhhc15bNP_001071249.1 zf-DHHC 16..292 CDD:303066 54/197 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..332
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.