DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17197 and Zdhhc16

DIOPT Version :9

Sequence 1:NP_651425.2 Gene:CG17197 / 43111 FlyBaseID:FBgn0039367 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001347605.1 Gene:Zdhhc16 / 74168 MGIID:1921418 Length:377 Species:Mus musculus


Alignment Length:308 Identity:74/308 - (24%)
Similarity:115/308 - (37%) Gaps:94/308 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 VLFVIVTT------IFFVVLQMF---YVVPQLFDVQGFMYKLGWLVAIFITYNIFGNMLACHITS 83
            |:.|||.|      .:..||.:.   |.||:|  ...|.|....|:.|...|         :...
Mouse    84 VVLVIVLTGSIVAIAYLCVLPLILRTYSVPRL--CWHFFYSHWNLILIVFHY---------YQAI 137

  Fly    84 TSVESLPKDRQIPEPEEEHQWHYCDVCEKLM---PPRSWHCILCKCCILKRDRHCIFTASCVGHN 145
            |:....|       |:..:......:|:|.:   |.|:.||.:|..|:||.|.||.:..:||||.
Mouse   138 TTPPGYP-------PQGRNDIATVSICKKCIYPKPARTHHCSICNRCVLKMDHHCPWLNNCVGHY 195

  Fly   146 NQRYFFWFTLFMALG------------------------------TGVALATHIIATLKYFSYSD 180
            |.||||.|..||.||                              ..:|..|:.......||:.:
Mouse   196 NHRYFFSFCFFMTLGCVYCSYGSWDLFREAYAAIEKMKQLDKNKLQAIANQTYHQTPPPTFSFRE 260

  Fly   181 LIFLNIPRDNLPPFWLVITLILNTYVFAAPVSSVLMQLSVLKNNGTLH----------------- 228
                .|...:|...|.:.:.:      |..:.::.|..:||.:.|...                 
Mouse   261 ----RITHKSLVYLWFLCSSV------ALALGALTMWHAVLISRGETSIERHINKKERRRLQAKG 315

  Fly   229 KFYSDTYDLGLWENFKLILG---GKGFWT-FLSPTVKSPLPH-DGAQW 271
            :.:.:.|:.|..:|:|:.||   |:.:.| .|.|:  |.||| :|..|
Mouse   316 RVFRNPYNYGCLDNWKVFLGVDTGRHWLTRVLLPS--SHLPHGNGMSW 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17197NP_651425.2 PHA02688 <9..70 CDD:222919 15/50 (30%)
zf-DHHC 100..>198 CDD:279823 34/130 (26%)
Zdhhc16NP_001347605.1 DHHC 156..305 CDD:396215 39/158 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.