DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17197 and Zdhhc4

DIOPT Version :9

Sequence 1:NP_651425.2 Gene:CG17197 / 43111 FlyBaseID:FBgn0039367 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_082655.1 Gene:Zdhhc4 / 72881 MGIID:1920131 Length:343 Species:Mus musculus


Alignment Length:272 Identity:58/272 - (21%)
Similarity:96/272 - (35%) Gaps:79/272 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 HPTAVLFVIVTTIFFVVLQMFYVVPQLFDVQGFMYKLGW------LVAIFITYNIFGNMLAC--- 79
            |||.:       :..::||.........:|.|:..:|.:      |..:.::.|:....|.|   
Mouse    65 HPTFI-------VLHLLLQGLVYAEYTCEVFGYCRELEFSLPYLLLPYVLLSVNLVFFTLTCAAN 122

  Fly    80 --HITSTSVESLPK-----DRQIPEPEEEHQWHYCDVCEKLMPPRSWHCILCKCCILKRDRHCIF 137
              .||..:...|.:     |...|:...      |..|:...|.||.||.||..|:.:.|.||::
Mouse   123 PGTITKANESFLLQVYKFDDVMFPKNSR------CPTCDLRKPARSKHCRLCDRCVHRFDHHCVW 181

  Fly   138 TASCVGHNNQRYFFWFTLFMALGTGVALATHIIATLKYFSYSDL--------------------- 181
            ..:|:|..|.|||..:.|.:...............|:..:.|||                     
Mouse   182 VNNCIGAWNTRYFLIYLLTLTASAATIATVTAAFLLRLVTVSDLYQETYLDDVGHFQAVDTVFLI 246

  Fly   182 --IFLNIPR-DNLPPFWLVITLILNTYVFAAPVSSVLMQLSVLKNNGTLHKFYSDTYDLGLWENF 243
              :||..|| ..|..|.:|::::|..|:..|        |.:...|.|.:::|            
Mouse   247 QHLFLAFPRIVFLLGFVIVLSMLLAGYLCFA--------LYLAATNQTTNEWY------------ 291

  Fly   244 KLILGGKGFWTF 255
                  ||.|.:
Mouse   292 ------KGDWAW 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17197NP_651425.2 PHA02688 <9..70 CDD:222919 9/51 (18%)
zf-DHHC 100..>198 CDD:279823 30/121 (25%)
Zdhhc4NP_082655.1 DHHC 151..292 CDD:396215 38/166 (23%)
Di-lysine motif. /evidence=ECO:0000250|UniProtKB:Q9NPG8 340..343
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.