DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17197 and Zdhhc24

DIOPT Version :9

Sequence 1:NP_651425.2 Gene:CG17197 / 43111 FlyBaseID:FBgn0039367 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_081752.2 Gene:Zdhhc24 / 70605 MGIID:1917855 Length:284 Species:Mus musculus


Alignment Length:277 Identity:77/277 - (27%)
Similarity:122/277 - (44%) Gaps:56/277 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VIVTTIF--FVVLQMFYVV------PQLFDVQGFMYK-LGWLVAIFITYNIFGNMLACHITSTSV 86
            :::|.::  .|||::.||:      |.|    |.:.: |...:|.:...|:.||::....:..|:
Mouse    19 LVLTALWAAVVVLELAYVMVLGPGPPPL----GPLARALQLALAAYQLLNLLGNVVLFLRSDPSI 79

  Fly    87 ES-LPKDRQIPEPEEEHQWHYCDVCEKLMPPRSWHCILCKCCILKRDRHCIFTASCVGHNNQRYF 150
            .. :...|.:.:     .|.||..|:..:||||.||..|:.|||:||.||.....|||.:|.|.|
Mouse    80 RGVMLAGRGLGQ-----GWAYCYQCQSQVPPRSGHCSACRVCILRRDHHCRLLGCCVGFHNYRPF 139

  Fly   151 FWFTLFMA---LGTGVALATHIIATLKYFS--YSDLIFLNIPRDNLPPFWLV------------I 198
            ....|..|   |...|.|...:.|.|:..|  |:..:.|      ||  ||:            :
Mouse   140 LCLLLHSAGVLLHISVLLGPALSALLQAHSALYTVALLL------LP--WLMLLTGKVSLAQFAL 196

  Fly   199 TLILNTYVFAAPV--SSVLMQLSVLKNNGTLHKFY--SDTYDLGLWENFKLILGGK----GFWTF 255
            ..:::|.|..|.:  :.:|....:|....|..::.  ...||||...|.:..||.:    .||.|
Mouse   197 AFVVDTCVAGALLCGAGLLFHGMLLLRGQTTWEWARGHHCYDLGTCHNLQAALGPRWALVWFWPF 261

  Fly   256 LSPTVKSPLPHDGAQWK 272
            |:    ||||.||..::
Mouse   262 LA----SPLPGDGISFQ 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17197NP_651425.2 PHA02688 <9..70 CDD:222919 11/47 (23%)
zf-DHHC 100..>198 CDD:279823 38/114 (33%)
Zdhhc24NP_081752.2 zf-DHHC 95..232 CDD:279823 43/144 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 81 1.000 Domainoid score I8468
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 122 1.000 Inparanoid score I4731
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG47998
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002152
OrthoInspector 1 1.000 - - otm42544
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1251
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.830

Return to query results.
Submit another query.