DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17197 and Zdhhc2

DIOPT Version :9

Sequence 1:NP_651425.2 Gene:CG17197 / 43111 FlyBaseID:FBgn0039367 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_848482.1 Gene:Zdhhc2 / 70546 MGIID:1923452 Length:366 Species:Mus musculus


Alignment Length:339 Identity:75/339 - (22%)
Similarity:116/339 - (34%) Gaps:121/339 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 QMFYVVPQLFDVQGFMYKLGW------LVAIFITYNIFGNMLAC----HITST--------SVES 88
            ::.|.:|.:|    ....|||      :....::....|..:.|    |:...        ::.:
Mouse    15 RVLYWIPVVF----ISLLLGWSYYAYAIQLCIVSMENIGEQVVCLMAYHLLFAMFVWSYWKTIFT 75

  Fly    89 LP-----------KDRQIPEPE---EEHQ--------------------WHYCDVCEKLMPPRSW 119
            ||           .::::.|.|   |.||                    ..|||.|:.:.|.|..
Mouse    76 LPMNPSKEFHLSYAEKELLEREPRGEAHQEVLRRAAKDLPIYTRTMSGAIRYCDRCQLIKPDRCH 140

  Fly   120 HCILCKCCILKRDRHCIFTASCVGHNNQRYFFWFTLFMALGTGVALATHIIAT-LKYFSYSDLIF 183
            ||.:|..||||.|.||.:..:|||.:|.::|..|..:..|     ....|.|| |:||.   ..:
Mouse   141 HCSVCDKCILKMDHHCPWVNNCVGFSNYKFFLLFLAYSLL-----YCLFIAATDLQYFI---RFW 197

  Fly   184 LNIPRDNLPPFWLVITLILNTYVFAAPVSSVLMQLS---------VLKNNGTLHKFYS------- 232
            .|...|....|.::...      |||.:.||  .||         |.||..||..|.:       
Mouse   198 TNGLPDTQAKFHIMFLF------FAAAMFSV--SLSSLFGYHCWLVSKNKSTLEAFRNPVFRHGT 254

  Fly   233 --DTYDLGLWENFKLILGG-KGFWTF-----------------------------LSPTVKSPLP 265
              :.:.||..:|.:.:.|. |.:|..                             |:.|||:|..
Mouse   255 DKNGFSLGFSKNMRQVFGDEKKYWLLPVFSSQGDGCSFPTCLVNQDPEQPSTPAGLNSTVKNPEN 319

  Fly   266 HDGAQWKIKRVQHH 279
            |......::..|.|
Mouse   320 HQFPAKPLRESQSH 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17197NP_651425.2 PHA02688 <9..70 CDD:222919 6/33 (18%)
zf-DHHC 100..>198 CDD:279823 35/118 (30%)
Zdhhc2NP_848482.1 DHHC 126..247 CDD:366691 45/136 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 296..366 8/38 (21%)
Mediates localization to plasma membrane and recycling endosomes. /evidence=ECO:0000269|PubMed:21471008 298..366 8/36 (22%)
Non-canonical dileucine endocytic signal. /evidence=ECO:0000269|PubMed:28768144 334..335 75/339 (22%)
NPxY-like endocytic signal. /evidence=ECO:0000269|PubMed:28768144 357..360
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.