DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17197 and ZDHHC6

DIOPT Version :9

Sequence 1:NP_651425.2 Gene:CG17197 / 43111 FlyBaseID:FBgn0039367 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001338011.1 Gene:ZDHHC6 / 64429 HGNCID:19160 Length:413 Species:Homo sapiens


Alignment Length:262 Identity:65/262 - (24%)
Similarity:101/262 - (38%) Gaps:62/262 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 FMYKLGWLVAIFITYNIFGNMLACHITSTSVESLPKDRQIPEPEEEHQW-HYCDVCEKLMPPRSW 119
            |:..:.|  .:.|.||.|..|.      .....:|...: ||..::..: .||.||:....|||.
Human    58 FIMLINW--TVMILYNYFNAMF------VGPGFVPLGWK-PEISQDTMYLQYCKVCQAYKAPRSH 113

  Fly   120 HCILCKCCILKRDRHCIFTASCVGHNNQRYFFWFTLFMALGTGVALATHIIATLKYFSYSDLIF- 183
            ||..|..|::|.|.||.:..:|.|:.|...|..|.|...||. :..|...:.|:....|..|.| 
Human   114 HCRKCNRCVMKMDHHCPWINNCCGYQNHASFTLFLLLAPLGC-IHAAFIFVMTMYTQLYHRLSFG 177

  Fly   184 ---LNIP-----RDNLP--PFWL--------VITLILNTYVFAAPVSSVLMQLSVLKNNGTLHKF 230
               :.|.     ||.||  ||.|        .:.|.|.|.:....:..:.|:: :|:|..::..:
Human   178 WNTVKIDMSAARRDPLPIVPFGLAAFATTLFALGLALGTTIAVGMLFFIQMKI-ILRNKTSIESW 241

  Fly   231 YSD-----------------TYDLG-LWENFKLILGGKGFWTFLSPTVKSPLPH-DGAQWKIKRV 276
            ..:                 .||:| .|.|||.:....|            :|. ||.:|.::..
Human   242 IEEKAKDRIQYYQLDEVFVFPYDMGSRWRNFKQVFTWSG------------VPEGDGLEWPVREG 294

  Fly   277 QH 278
            .|
Human   295 CH 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17197NP_651425.2 PHA02688 <9..70 CDD:222919 3/13 (23%)
zf-DHHC 100..>198 CDD:279823 36/117 (31%)
ZDHHC6NP_001338011.1 DHHC 95..241 CDD:396215 42/147 (29%)
SH3 317..394 CDD:418401
Di-lysine motif. /evidence=ECO:0000269|PubMed:21926431 410..413
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.