DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17197 and zdhhc5a

DIOPT Version :9

Sequence 1:NP_651425.2 Gene:CG17197 / 43111 FlyBaseID:FBgn0039367 Length:290 Species:Drosophila melanogaster
Sequence 2:XP_005160301.1 Gene:zdhhc5a / 571795 ZFINID:ZDB-GENE-090312-92 Length:760 Species:Danio rerio


Alignment Length:222 Identity:53/222 - (23%)
Similarity:88/222 - (39%) Gaps:52/222 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 PKIFVRISHPTAVLFVIVTTIFFV-----VLQMFYVVPQLFDVQGFMYKL-GWLVAIFITYNIFG 74
            |..:|.:|..||.| |..||:||.     :.:.|.|...:::...||:.| .:.:|.|:...|| 
Zfish    28 PSRYVPVSAATAFL-VGSTTLFFCFTCPWLSEQFSVAVPIYNGVMFMFVLANFCMATFMDPGIF- 90

  Fly    75 NMLACHITSTSVESLPKDRQIPEPEEEH---------------QWHYCDVCEKLMPPRSWHCILC 124
                           |:..:..:.|::.               :..:|..|....|||..||.:|
Zfish    91 ---------------PRAEEDEDKEDDFRAPLYKTVEIRGIQVRMKWCSTCRFYRPPRCSHCSVC 140

  Fly   125 KCCILKRDRHCIFTASCVGHNNQRYFFWFTLFMALGTGVALATHIIATLKYFSYSDLIFLNIPRD 189
            ..|:...|.||.:..:|:|..|.||||.|.|        :|..||:....:    .|:|:.....
Zfish   141 DNCVEDFDHHCPWVNNCIGRRNYRYFFLFLL--------SLTAHIMGVFGF----GLLFILYHTQ 193

  Fly   190 NLPPFWLVITLILNTY--VFAAPVSSV 214
            .|......:|:.:...  :|..||:.:
Zfish   194 QLDRVHSAVTMAVMCVAGLFFIPVAGL 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17197NP_651425.2 PHA02688 <9..70 CDD:222919 18/59 (31%)
zf-DHHC 100..>198 CDD:279823 27/112 (24%)
zdhhc5aXP_005160301.1 zf-DHHC 116..241 CDD:279823 31/117 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.