DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17197 and zdhhc14

DIOPT Version :9

Sequence 1:NP_651425.2 Gene:CG17197 / 43111 FlyBaseID:FBgn0039367 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001038652.1 Gene:zdhhc14 / 569667 ZFINID:ZDB-GENE-040724-21 Length:513 Species:Danio rerio


Alignment Length:282 Identity:69/282 - (24%)
Similarity:112/282 - (39%) Gaps:66/282 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 TAVLFVIVTTIFFVVLQMFY---VVPQLFDVQG--FMYKLGWLV-AIFITYNIFGNMLACHITST 84
            |.||.::.:.:||.....|.   :.|.:..:.|  |::.:|.|: |.|....:...       :|
Zfish    66 TMVLILVTSGLFFAFDCPFLASNLTPAIPAIGGVLFVFVMGMLLRASFSDPGVLPR-------AT 123

  Fly    85 SVESLPKDRQI------------PEPEEEH--------QWHYCDVCEKLMPPRSWHCILCKCCIL 129
            ..|:...:|||            |.|....        :..||..|:...|||:.||.||..|:.
Zfish   124 PEEAADIERQIDANNGPSGPGYRPPPRTREVLINGQTVKLKYCFTCKIFRPPRASHCSLCDNCVD 188

  Fly   130 KRDRHCIFTASCVGHNNQRYFFWFTL---FMALGTGVALATHII--ATLKYFSYSDLI-FLNIPR 188
            :.|.||.:..:|||..|.|:|:.|.|   |:.:.....:.||:|  |..|..:.|... |..:.:
Zfish   189 RFDHHCPWVGNCVGRRNYRFFYLFILSLSFLTIFIFAFVITHVILNALRKALALSTAADFEAVQK 253

  Fly   189 DNLPPFWLVITLILNTYVFAAPVSSVLMQLSVLKNNGTLHKFYSDTYDLGLWENFKLILGGKGFW 253
            |   |..|...::..|.:           |.||:   .:..|:|      :|.    |:|..||.
Zfish   254 D---PTGLAFLVLSKTAL-----------LDVLE---VVVCFFS------VWS----IVGLSGFH 291

  Fly   254 TFLSPTVKSPLPHDGAQWKIKR 275
            |:|..:.::........|..||
Zfish   292 TYLISSNQTTNEDIKGSWSSKR 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17197NP_651425.2 PHA02688 <9..70 CDD:222919 13/49 (27%)
zf-DHHC 100..>198 CDD:279823 33/111 (30%)
zdhhc14NP_001038652.1 zf-DHHC 163..306 CDD:279823 46/169 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 348..369
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.