DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17197 and zdhhc18a

DIOPT Version :9

Sequence 1:NP_651425.2 Gene:CG17197 / 43111 FlyBaseID:FBgn0039367 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001071031.1 Gene:zdhhc18a / 564062 ZFINID:ZDB-GENE-060929-424 Length:467 Species:Danio rerio


Alignment Length:278 Identity:62/278 - (22%)
Similarity:105/278 - (37%) Gaps:77/278 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PTAVLFVIVTTIFFVVLQMFYVVPQLFDVQGFMYKLGWLVAIFITYNIFGNMLACHITSTSV--E 87
            |..:..:.:|::.|......::|..|   ..|:..:|.::.||:..    ::|....|...:  .
Zfish    64 PLTIGLIFITSVLFFTFDCPFLVDHL---TVFIPVIGGVLFIFVVI----SLLQTSFTDPGILPR 121

  Fly    88 SLPK-----DRQI---------PEPEEEH--------QWHYCDVCEKLMPPRSWHCILCKCCILK 130
            :||.     ::||         |.|..:.        :..||..|....|||:.||.||..|:.:
Zfish   122 ALPDEAADIEKQIDNSGSSTYRPPPRTKEILINDQVVKLKYCFTCRMFRPPRTSHCSLCDNCVER 186

  Fly   131 RDRHCIFTASCVGHNNQRYFFWFTLFMALGTGV---ALATHIIATLKYFSYSDLIFLNIPRDNLP 192
            .|.||.:..:|||..|.|:|:.|.:.::..|..   .:.||:  ||:  |.....|:...:|   
Zfish   187 FDHHCPWVGNCVGKRNYRFFYAFIVSLSFLTSFIFGCVITHL--TLR--SQGGNGFIQAIQD--- 244

  Fly   193 PFWLVITLILNTYVFAAPVSSVLMQLSVLKNNGTLHKFYSDTYDLGLWENFKLILGGKGFWTFLS 257
                            :|.|.|.:.:.          |:|      :|.    |||..||.|:|.
Zfish   245 ----------------SPASVVELVIC----------FFS------IWS----ILGLSGFHTYLV 273

  Fly   258 PTVKSPLPHDGAQWKIKR 275
            .:..:........|..||
Zfish   274 ASNLTTNEDIKGSWSSKR 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17197NP_651425.2 PHA02688 <9..70 CDD:222919 9/44 (20%)
zf-DHHC 100..>198 CDD:279823 29/108 (27%)
zdhhc18aNP_001071031.1 zf-DHHC 160..284 CDD:279823 42/166 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.