DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17197 and zdhhc9

DIOPT Version :9

Sequence 1:NP_651425.2 Gene:CG17197 / 43111 FlyBaseID:FBgn0039367 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001103496.1 Gene:zdhhc9 / 560095 ZFINID:ZDB-GENE-071004-8 Length:382 Species:Danio rerio


Alignment Length:291 Identity:66/291 - (22%)
Similarity:117/291 - (40%) Gaps:78/291 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LIWACTKYLARRNPKIFVRISHPTAVLFVIVTTIFFVVLQMFYVVPQLFDVQGFMYKLGWLVAIF 67
            ::..|:.:.|...|.:.|.:| |...:|.::..:|.:.:    ::...|...|.:.:.....|.|
Zfish    41 IVGTCSLFFAFECPYLAVHLS-PAIPVFAVLLFVFVMAM----LLRTSFSDPGVLPRALPEEANF 100

  Fly    68 ITYNI---FGNMLACHITSTSVESLPKDRQIPEPEEEHQWHYCDVCEKLMPPRSWHCILCKCCIL 129
            |...|   .||:||.......::::..:.||.:.:      ||..|:...|||:.||.:|..|:.
Zfish   101 IEMEIEAANGNVLAGQRPPPRIKNVQINNQIVKLK------YCYTCKIFRPPRASHCSICDNCVD 159

  Fly   130 KRDRHCIFTASCVGHNNQRYFFWFTLFMALGTGVALATHIIATLKYFSYSDLIFLNIPRDNLPPF 194
            :.|.||.:..:|||..|.|||:.|||.::|                                   
Zfish   160 RFDHHCPWVGNCVGKRNYRYFYLFTLSLSL----------------------------------- 189

  Fly   195 WLVITLILNTYVFAAPVSSVLMQ------LSVLKNN-GTLHK----FYSDTYDLGLWENFKLILG 248
                   |..|:||..:..|:::      ::.||.. ||:.:    |::      ||.    ::|
Zfish   190 -------LTIYIFAFDIVHVVLRSVDSGFVNTLKETPGTVLEVLVCFFT------LWS----VVG 237

  Fly   249 GKGFWTFLSPTVKSPLPHDGAQWKIK-RVQH 278
            ..||.|:|....::........|..| |||:
Zfish   238 LTGFHTYLISLNQTTNEDIKGSWSGKNRVQN 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17197NP_651425.2 PHA02688 <9..70 CDD:222919 12/60 (20%)
zf-DHHC 100..>198 CDD:279823 24/97 (25%)
zdhhc9NP_001103496.1 zf-DHHC 134..257 CDD:279823 41/180 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.