DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17197 and zdhhc2

DIOPT Version :9

Sequence 1:NP_651425.2 Gene:CG17197 / 43111 FlyBaseID:FBgn0039367 Length:290 Species:Drosophila melanogaster
Sequence 2:XP_021336686.1 Gene:zdhhc2 / 541365 ZFINID:ZDB-GENE-050320-58 Length:374 Species:Danio rerio


Alignment Length:184 Identity:55/184 - (29%)
Similarity:76/184 - (41%) Gaps:39/184 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 YCDVCEKLMPPRSWHCILCKCCILKRDRHCIFTASCVGHNNQRYFFWFTLFMALGTGVALATHII 170
            |||.|..|.|.|..||..|..||||.|.||.:..:|||..|.::|..|..:..|......||   
Zfish   125 YCDRCLLLKPDRCHHCSACDMCILKMDHHCPWVNNCVGFANYKFFMLFLAYSLLYCLFVTAT--- 186

  Fly   171 ATLKYF---------SYSDLI-FLNIPRDNLPPFWLVITLILNTYVFAAPVSSVLMQL------- 218
             .::||         ::..|| :||...|....|.::...      |||...||.:..       
Zfish   187 -DMQYFIQFWTVDGKTHDRLIQYLNGLPDTQAKFHIMFLF------FAASTFSVSLAFLFAYHCW 244

  Fly   219 SVLKNNGTLHKFYS---------DTYDLGLWENFKLILGG-KGFWTFLSPTVKS 262
            .|.||..||..|.:         :.:.||.::||:.:.|. |.:|  |.|...|
Zfish   245 LVCKNRSTLEAFRAPAFQHGTDKNGFSLGAYKNFRQVFGDEKKYW--LLPIFSS 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17197NP_651425.2 PHA02688 <9..70 CDD:222919
zf-DHHC 100..>198 CDD:279823 34/101 (34%)
zdhhc2XP_021336686.1 zf-DHHC 11..305 CDD:327686 55/184 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.