DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17197 and ZDHHC2

DIOPT Version :9

Sequence 1:NP_651425.2 Gene:CG17197 / 43111 FlyBaseID:FBgn0039367 Length:290 Species:Drosophila melanogaster
Sequence 2:XP_011542846.1 Gene:ZDHHC2 / 51201 HGNCID:18469 Length:412 Species:Homo sapiens


Alignment Length:176 Identity:52/176 - (29%)
Similarity:76/176 - (43%) Gaps:36/176 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 YCDVCEKLMPPRSWHCILCKCCILKRDRHCIFTASCVGHNNQRYFFWFTLFMALGTGVALATHII 170
            |||.|:.:.|.|..||.:|..||||.|.||.:..:|||.:|.::|..|..:..|......||.:.
Human   173 YCDRCQLIKPDRCHHCSVCDKCILKMDHHCPWVNNCVGFSNYKFFLLFLAYSLLYCLFIAATDLQ 237

  Fly   171 ATLKYFSYSDLIFLNIPRDNLPPFWLVITLILNTYVFAAPVSSVLMQLS---------VLKNNGT 226
            ..:|:::.      .:| |....|.::...      |||.:.||  .||         |.||..|
Human   238 YFIKFWTN------GLP-DTQAKFHIMFLF------FAAAMFSV--SLSSLFGYHCWLVSKNKST 287

  Fly   227 LHKFYS---------DTYDLGLWENFKLILGG-KGFWTFLSPTVKS 262
            |..|.|         :.:.||..:|.:.:.|. |.:|  |.|...|
Human   288 LEAFRSPVFRHGTDKNGFSLGFSKNMRQVFGDEKKYW--LLPIFSS 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17197NP_651425.2 PHA02688 <9..70 CDD:222919
zf-DHHC 100..>198 CDD:279823 29/91 (32%)
ZDHHC2XP_011542846.1 zf-DHHC 172..293 CDD:279823 42/134 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.