DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17197 and ZDHHC9

DIOPT Version :9

Sequence 1:NP_651425.2 Gene:CG17197 / 43111 FlyBaseID:FBgn0039367 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001008223.1 Gene:ZDHHC9 / 51114 HGNCID:18475 Length:364 Species:Homo sapiens


Alignment Length:271 Identity:63/271 - (23%)
Similarity:101/271 - (37%) Gaps:106/271 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LFVIV--TTIFF------VVLQMFYVVPQLFDVQGFMYKLGWLV-----------------AIFI 68
            ||:|:  .|:||      :.:|:...:| :|....|::.:..|:                 |.||
Human    42 LFLILGTCTLFFAFECRYLAVQLSPAIP-VFAAMLFLFSMATLLRTSFSDPGVIPRALPDEAAFI 105

  Fly    69 TYNIFGNMLACHITSTSVESLPKDRQIPEPEEEHQWH-------YCDVCEKLMPPRSWHCILCKC 126
            ...|       ..|:.:|   |:.::.|...:..|.:       ||..|:...|||:.||.:|..
Human   106 EMEI-------EATNGAV---PQGQRPPPRIKNFQINNQIVKLKYCYTCKIFRPPRASHCSICDN 160

  Fly   127 CILKRDRHCIFTASCVGHNNQRYFFWFTLFMALGTGVALATHIIATLKYFSYSDLIFLNIPRDNL 191
            |:.:.|.||.:..:|||..|.|||:.|.|.::|                                
Human   161 CVERFDHHCPWVGNCVGKRNYRYFYLFILSLSL-------------------------------- 193

  Fly   192 PPFWLVITLILNTYVFAAPVSSVLMQ------LSVLKNN-GTLHK----FYSDTYDLGLWENFKL 245
                      |..||||..:..|.::      |..||.. ||:.:    |::      ||.    
Human   194 ----------LTIYVFAFNIVYVALKSLKIGFLETLKETPGTVLEVLICFFT------LWS---- 238

  Fly   246 ILGGKGFWTFL 256
            ::|..||.|||
Human   239 VVGLTGFHTFL 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17197NP_651425.2 PHA02688 <9..70 CDD:222919 14/65 (22%)
zf-DHHC 100..>198 CDD:279823 24/104 (23%)
ZDHHC9NP_001008223.1 DHHC 138..261 CDD:396215 43/164 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 303..364
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.