DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17197 and Zdhhc14

DIOPT Version :9

Sequence 1:NP_651425.2 Gene:CG17197 / 43111 FlyBaseID:FBgn0039367 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001034432.1 Gene:Zdhhc14 / 499014 RGDID:1565877 Length:489 Species:Rattus norvegicus


Alignment Length:324 Identity:68/324 - (20%)
Similarity:118/324 - (36%) Gaps:106/324 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KYLARRNPKIF-----------VRISHPTAVLF-----VIVTTIFFVVLQMFY----VVPQLFDV 53
            |..|||..::|           :.::..|.|.:     ::||:..|......|    :.|.:..|
  Rat    33 KIAARRKWEVFPGRNKFFCNGRIMMARQTGVFYLTLILILVTSGLFFAFDCRYLAEKITPAIPVV 97

  Fly    54 QGFMYKLGWLVAIFITYNIFGNMLACHITSTSV-------ESLPKDRQI------------PEPE 99
            .|.::           :.:.|.:|....:...|       |:...:|||            |.|.
  Rat    98 GGILF-----------FFVMGTLLRTSFSDPGVLPRATPDEAADLERQIDIANGTSSGGYRPPPR 151

  Fly   100 EEH--------QWHYCDVCEKLMPPRSWHCILCKCCILKRDRHCIFTASCVGHNNQRYFFWFTLF 156
            .:.        :..||..|:...|||:.||.||..|:.:.|.||.:..:|||..|.|:|:.|.|.
  Rat   152 TKEVIINGQTVKLKYCFTCKIFRPPRASHCSLCDNCVEQFDHHCPWVGNCVGKRNYRFFYMFILS 216

  Fly   157 MALGTGVALA---THIIATLKYFSYSDLIFLNIPRDNLPPFWLVITLILNTYVFAAPVSSVLMQL 218
            ::..|....|   ||:|...:...:.|.:     :|:  |              |:.:.:|:...
  Rat   217 LSFLTVFIFAFVITHVIHRSQQKGFLDAL-----KDS--P--------------ASVLEAVICFF 260

  Fly   219 SVLKNNGTLHKFYSDTYDLGLWENFKLILGGKGFWTFLSPTVKSPLPHDGAQWKIKR-VQHHSP 281
            ||                   |.    |:|..||.|:|..:.::........|..|| .::::|
  Rat   261 SV-------------------WS----IIGLSGFHTYLISSNQTTNEDIKGSWSNKRGKENYNP 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17197NP_651425.2 PHA02688 <9..70 CDD:222919 14/80 (18%)
zf-DHHC 100..>198 CDD:279823 30/108 (28%)
Zdhhc14NP_001034432.1 DHHC 164..287 CDD:396215 41/166 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.