DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17197 and Zdhhc11

DIOPT Version :9

Sequence 1:NP_651425.2 Gene:CG17197 / 43111 FlyBaseID:FBgn0039367 Length:290 Species:Drosophila melanogaster
Sequence 2:XP_038942712.1 Gene:Zdhhc11 / 499000 RGDID:1564281 Length:364 Species:Rattus norvegicus


Alignment Length:286 Identity:60/286 - (20%)
Similarity:101/286 - (35%) Gaps:89/286 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 PQLFDVQGFMYKLGWLVAIFITYNIF----------------GNM----LACHITSTSVE----- 87
            |.|...|...:.. :|....:|:.||                |.:    |..|:.:.:::     
  Rat    39 PPLHSFQAISWTT-YLAMSIVTFGIFIPFLPTSWKYAANAVMGGVFMFHLVVHLIAITIDPADTN 102

  Fly    88 -SLPKDRQIPEPEEEHQWH-------YCDVCEKLMPPRSWHCILCKCCILKRDRHCIFTASCVGH 144
             .|.||...|.|..:...|       ||.:||..:..::.||..|..|:...|.||.:..:|||.
  Rat   103 VRLKKDYLEPVPTFDRSKHAHVIQNQYCHLCEVTVSKKAKHCSSCNKCVSGFDHHCKWLNNCVGK 167

  Fly   145 NNQRYFFWFTLFMALGTGVALATHIIATLKYF---------------------SYSDL-IFLNIP 187
            .|..:||:.....|.|....|...:...::||                     .::.| :|:.|.
  Rat   168 RNYWFFFFSVASAAFGLLGVLIILLYIFIQYFVNPNGLRMDPLYKGAAVWIGAGWTCLSVFIEIS 232

  Fly   188 RDNLPPFWLVITLILNTYVFAAPV----SSVLMQLS----VLKNNGTLHKFY-----SDTYDLGL 239
            .:|.   ||:. |.|:......||    :::::.|:    ||..:..:..||     ..|:|..:
  Rat   233 SENT---WLLF-LSLSPVPVKTPVVLSIAAMVLLLAIASFVLLGHLLVFHFYLISKKLSTFDYMM 293

  Fly   240 WENFKLILGGKGFWTFLSPTVKSPLP 265
            ...|:                |||.|
  Rat   294 QTRFQ----------------KSPRP 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17197NP_651425.2 PHA02688 <9..70 CDD:222919 4/21 (19%)
zf-DHHC 100..>198 CDD:279823 29/126 (23%)
Zdhhc11XP_038942712.1 DHHC 123..294 CDD:396215 39/174 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.