DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17197 and CG5880

DIOPT Version :9

Sequence 1:NP_651425.2 Gene:CG17197 / 43111 FlyBaseID:FBgn0039367 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_651539.3 Gene:CG5880 / 43268 FlyBaseID:FBgn0039489 Length:381 Species:Drosophila melanogaster


Alignment Length:360 Identity:86/360 - (23%)
Similarity:126/360 - (35%) Gaps:132/360 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VIVTTIFFVV------LQMFYVV---PQLFDVQGFMYKLG----WLVAIFITY--NIFGNMLACH 80
            |.:|.||:.|      |..|:||   .....|....|.:|    |..:..:||  .|.||.|..:
  Fly    46 VCLTPIFWFVDNYTHCLGPFFVVGVAALTTSVVSIAYWIGLPFWWAKSQLVTYFLLIVGNWLLLN 110

  Fly    81 ITSTSVESL-------PKDRQIPEPEEEHQWHYCDVCEKLMPPRSWHCILCKCCILKRDRHCIFT 138
            :....|.::       |:...:.|...     .|..|....|||:.||.:|..||||.|.||.:.
  Fly   111 VVFHYVMAVITPAGHPPEGVSLVEAVS-----MCGKCIAPKPPRTHHCSICNRCILKMDHHCPWL 170

  Fly   139 ASCVGHNNQRYFFWFTLFMALG------------------------TGVA----------LATHI 169
            .:|||:.|.||||.:..:..||                        |.:.          |:.||
  Fly   171 NNCVGYGNHRYFFLYMTYTTLGCLFLILFGLEIGHKYLWLDHGENWTEIEPLEGQPVKFNLSGHI 235

  Fly   170 IATLKYFSYSDLIFLNIPR--DNLPPFWLVITLILNT-----------YVFAAPVSSVLMQLSVL 221
            |.......|.:.:   :|.  .|||      |.|::|           :..|....:|::.|..|
  Fly   236 IPVTHPNEYDEFV---LPPAVHNLP------TPIVDTDAASPGRRRALWFMAFTNVAVVLALGSL 291

  Fly   222 ------------------------KNNGTLHKFYSDTYDLGLWENFKLILG---GKGFW-TFLSP 258
                                    |.:....:.|.:.|:.|..:|:||.||   |:.|| |.|.|
  Fly   292 SIWHAKLITRGETSVEAHINEAERKRHLQQQRIYINPYNFGTKKNWKLFLGLVRGRSFWRTVLLP 356

  Fly   259 TVKSPLPHDGAQWKIKRVQHHSPK---LQFLRVSD 290
            :           |       |.|:   |.|..|:|
  Fly   357 S-----------W-------HKPEGTGLSFHTVND 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17197NP_651425.2 PHA02688 <9..70 CDD:222919 13/51 (25%)
zf-DHHC 100..>198 CDD:279823 35/133 (26%)
CG5880NP_651539.3 zf-DHHC 139..>201 CDD:279823 25/61 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.