DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17197 and CG17195

DIOPT Version :9

Sequence 1:NP_651425.2 Gene:CG17197 / 43111 FlyBaseID:FBgn0039367 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_651427.2 Gene:CG17195 / 43113 FlyBaseID:FBgn0039369 Length:283 Species:Drosophila melanogaster


Alignment Length:288 Identity:135/288 - (46%)
Similarity:184/288 - (63%) Gaps:14/288 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MCLIWACTKYLARRNPKIFVRISHPTAVLFVIVTTIFFVVLQMFYVVPQLF-DVQGFMYKLGWLV 64
            ||.:.....|.|.|.||.||||.||.:::||:.:|.||..|||||:.|::| |:   .|||.|::
  Fly     1 MCYVNRFCHYFANRYPKNFVRIVHPLSIVFVLCSTAFFFSLQMFYIAPKVFGDI---AYKLYWIL 62

  Fly    65 AIFITYNIFGNMLACHITSTSVESLPKDRQIPEPEEEHQWHYCDVCEKLMPPRSWHCILCKCCIL 129
            ..|||:||.||||||::||:||.:|.||.:.|.||:|..||||:.|:||..||||||:||..|||
  Fly    63 VTFITHNILGNMLACYMTSSSVNTLSKDSRCPNPEDEPLWHYCESCKKLRSPRSWHCVLCNTCIL 127

  Fly   130 KRDRHCIFTASCVGHNNQRYFFWFTLFMALGTGVALATHIIATLK----YFSYSDLIFLNIPRDN 190
            :||.|||||.:|:||||||:|||||.::.||...:.||..:..|:    :.|.|.:||..|.|..
  Fly   128 RRDHHCIFTGTCIGHNNQRFFFWFTFYLTLGLVTSFATFCMFILQNGGNFMSLSSVIFNLITRTF 192

  Fly   191 LPPF----WLVITLILNTYVFAAPVSSVLMQLSVLKNNGTLHKFYSDTYDLGLWENFKLILGGKG 251
            ...:    :..|..:||......|...:..|:.:|..|.|.:..:..|||||..:|.:.|:|.:|
  Fly   193 FQNYTGNTFETIAFLLNISASYMPAFMLAYQMQILSQNSTYYNIFDCTYDLGFRKNCQTIMGQRG 257

  Fly   252 FWTFLSPTVKSPLPHDGAQWKIKRVQHH 279
            .|||:||.:|||||||||.|::|  |.|
  Fly   258 LWTFISPLLKSPLPHDGAHWQMK--QSH 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17197NP_651425.2 PHA02688 <9..70 CDD:222919 30/61 (49%)
zf-DHHC 100..>198 CDD:279823 49/105 (47%)
CG17195NP_651427.2 zf-DHHC 103..234 CDD:279823 55/130 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469531
Domainoid 1 1.000 76 1.000 Domainoid score I5810
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I3587
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002152
OrthoInspector 1 1.000 - - otm26486
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22883
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1251
98.890

Return to query results.
Submit another query.