DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17197 and CG5196

DIOPT Version :9

Sequence 1:NP_651425.2 Gene:CG17197 / 43111 FlyBaseID:FBgn0039367 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_650191.1 Gene:CG5196 / 41522 FlyBaseID:FBgn0038039 Length:427 Species:Drosophila melanogaster


Alignment Length:313 Identity:77/313 - (24%)
Similarity:117/313 - (37%) Gaps:95/313 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 NPKI--FVRISH--PTAVLFVI----VTTIFFVVLQMFYVVPQLFDVQGFMYKLGWLVAIFI--- 68
            :|:|  |.|..|  |...|.:|    :||::  :..|::  |......||.::     |:|:   
  Fly     2 SPEISGFRRFLHWGPITALSIIKCITLTTLY--MNSMWW--PPNKSFAGFAHQ-----ALFLLLS 57

  Fly    69 TYNIFGNMLACHITSTSVESLPKDRQIPEPEEEHQWHYCDVCEKLMPPRSWHCILCKCCILKRDR 133
            |...|..::|   |.|....:||.....:|::.....||..||....|||.||..|..|:.|.|.
  Fly    58 TLATFNYVMA---TLTGPGLMPKQWHPKDPKDAQFLQYCKKCEGYKAPRSHHCRKCDRCVKKMDH 119

  Fly   134 HCIFTASCVGHNNQRYFFWFTLFMALGT--GVAL--------------ATHIIATLKYFSYSDLI 182
            ||.:...|||..|..||.:|.||..||:  |..:              .||.:|.|....::.| 
  Fly   120 HCPWINHCVGWANHAYFTYFLLFSILGSLQGTVVLCCSFWRGIYRYYYLTHGLAHLASVQFTLL- 183

  Fly   183 FLNIPRDNLPPFWLVITLILNTYVFAAPVSSVLM----QLSVLKNNGT----------LHKFYSD 233
                         .:|..||...:....|..:.|    ||..:.||.|          :::.|.:
  Fly   184 -------------SIIMCILGMGLAIGVVIGLSMLLFIQLKTIVNNQTGIEIWIVEKAIYRRYRN 235

  Fly   234 T---------YDLGLWENFKLILGG----KGFWTFLSPTVKSPLPHDGAQWKI 273
            .         ||||...|.:|:...    :|               ||.:|.:
  Fly   236 ADCDDEFLYPYDLGWRANLRLVFNDECQKRG---------------DGIEWPV 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17197NP_651425.2 PHA02688 <9..70 CDD:222919 16/65 (25%)
zf-DHHC 100..>198 CDD:279823 32/113 (28%)
CG5196NP_650191.1 zf-DHHC 89..223 CDD:279823 42/147 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467507
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.