DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17197 and zgc:77880

DIOPT Version :9

Sequence 1:NP_651425.2 Gene:CG17197 / 43111 FlyBaseID:FBgn0039367 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_957185.1 Gene:zgc:77880 / 393865 ZFINID:ZDB-GENE-040426-1901 Length:297 Species:Danio rerio


Alignment Length:161 Identity:46/161 - (28%)
Similarity:69/161 - (42%) Gaps:24/161 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 FVIVTTIFFVVLQMFYVVPQLFDVQGFMYKLGWLVAIFITYN-IFGNMLACHITSTSVESLPKDR 93
            |:.:...:|.|....|||.|...:..:...: |.......:| |...:||||  |.:|.|.|  .
Zfish    13 FICLILTYFSVFYADYVVIQYVLIPAYSGSV-WCTLHGSVFNIILFLLLACH--SKAVFSDP--G 72

  Fly    94 QIPEPEEE------------------HQWHYCDVCEKLMPPRSWHCILCKCCILKRDRHCIFTAS 140
            .:|.||..                  ..|..|..||...|||:.||.:|:.||.:.|.||.:..:
Zfish    73 MVPLPETAIDFSDLRSQSNRLNDRGCEGWTVCSRCETYRPPRAHHCRVCQRCIRRMDHHCPWINN 137

  Fly   141 CVGHNNQRYFFWFTLFMALGTGVALATHIIA 171
            |||..||:||..|..:..:.:..::|..:.|
Zfish   138 CVGELNQKYFIQFLFYTGMASLYSMALVVSA 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17197NP_651425.2 PHA02688 <9..70 CDD:222919 8/39 (21%)
zf-DHHC 100..>198 CDD:279823 25/90 (28%)
zgc:77880NP_957185.1 zf-DHHC 12..>164 CDD:303066 44/155 (28%)
zf-DHHC 103..235 CDD:279823 24/66 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.