DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17197 and CG4483

DIOPT Version :9

Sequence 1:NP_651425.2 Gene:CG17197 / 43111 FlyBaseID:FBgn0039367 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_648294.1 Gene:CG4483 / 39057 FlyBaseID:FBgn0035970 Length:435 Species:Drosophila melanogaster


Alignment Length:252 Identity:56/252 - (22%)
Similarity:94/252 - (37%) Gaps:67/252 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 YKLGWLVAIFITYNIFGNM--------LACHITSTSVESLPKDRQIPEPEEEHQWHYCDVCEKLM 114
            |.|.|:......||...::        |..|      ..|.||:...:        :|..|....
  Fly    51 YALIWIQTFGTLYNFIRSLMVGPGFVPLKWH------PQLTKDKMFLQ--------FCTRCNGYK 101

  Fly   115 PPRSWHCILCKCCILKRDRHCIFTASCVGHNNQRYFFWFTLFMALGT---GVALATHIIATLK-- 174
            .|||.||..|..|::|.|.||.:..:|||.:||..|.:|.||...|:   |:.:.:.:|..:|  
  Fly   102 APRSHHCRRCNRCVMKMDHHCPWINTCVGWSNQDSFVYFLLFFMSGSIHGGIIIVSAVIRGIKKR 166

  Fly   175 ---YFSYSDLIFLNIPRDNLPPFWLVITLILNTYVFAAPVSSVLMQL-SVLKNNGTLH------- 228
               .:....:..:::.:.||......:.:|:.|.:  |.:..:.||: |:|||...:.       
  Fly   167 WLIRYGLRHMATVHLTQTNLLACVFSLGVIMGTVL--ASIKLLYMQMKSILKNQTEIENWIVKKA 229

  Fly   229 ------------KFYSDTYDLGLWENFKLILGGKGFWTFLSPTVKSPLPHDGAQWKI 273
                        |.:...|:||...|.:.:....|               ||..|.:
  Fly   230 AFRRNAYPRKGIKPFVYPYNLGWKTNMREVFFSTG---------------DGISWPV 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17197NP_651425.2 PHA02688 <9..70 CDD:222919 3/11 (27%)
zf-DHHC 100..>198 CDD:279823 28/105 (27%)
CG4483NP_648294.1 zf-DHHC 88..224 CDD:279823 37/145 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467515
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.