DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17197 and Zdhhc12

DIOPT Version :9

Sequence 1:NP_651425.2 Gene:CG17197 / 43111 FlyBaseID:FBgn0039367 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001013257.1 Gene:Zdhhc12 / 366014 RGDID:1306593 Length:267 Species:Rattus norvegicus


Alignment Length:284 Identity:71/284 - (25%)
Similarity:110/284 - (38%) Gaps:79/284 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 NPKIFVRISHP------TAVLFVIVTTIFFVVLQMFYVVPQLFDVQGFMYKLGWLVAIFITYNIF 73
            |..:.||..|.      |.|||:..|.:            :.::.||.::    |...|:.. :.
  Rat     8 NSGMLVRTGHTVLTWGITLVLFLHDTEL------------RQWEEQGELF----LPLTFLLL-VL 55

  Fly    74 GNMLACHITSTS----VESLPKDRQIPEPEEEH--------QWHYCDVCEKLMPPRSWHCILCKC 126
            |::|.....|..    |.:.|:.::  ||:||.        ....|..|..|.|.|:.||..|:.
  Rat    56 GSLLLYLAVSLMDPGYVTAQPQPQE--EPKEEQTAMVPQAIPLRRCRYCLVLQPLRARHCRECRR 118

  Fly   127 CILKRDRHCIFTASCVGHNNQRYFFWFTLFMALGTGVALATHIIATL--KYFSYSDLIFLNIPRD 189
            |:.:.|.||.:..:|||..|.      .||:|.     ||..::..|  .|.::|.|.|..    
  Rat   119 CVRRYDHHCPWMENCVGERNH------PLFVAY-----LALQLVVLLWGLYLAWSGLQFFQ---- 168

  Fly   190 NLPPF--WLVIT-LILNTYV---FAAPVSSVLM--QLSVLKNNGTLHKFY------------SDT 234
               |:  ||..| |:..|::   |.|.|.|:|:  .|.::..|.|..:|.            |:.
  Rat   169 ---PWGLWLRSTGLLFTTFLLLSFFALVVSLLLASHLYLVARNTTTWEFISSHRIAYLRQRTSNP 230

  Fly   235 YDLGLWENFKLILGG--KGFWTFL 256
            :|.|...|......|  .|.|..|
  Rat   231 FDRGPTRNLAHFFCGWPSGPWETL 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17197NP_651425.2 PHA02688 <9..70 CDD:222919 13/60 (22%)
zf-DHHC 100..>198 CDD:279823 31/109 (28%)
Zdhhc12NP_001013257.1 DHHC <123..217 CDD:396215 32/111 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.