DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17197 and Zdhhc18

DIOPT Version :9

Sequence 1:NP_651425.2 Gene:CG17197 / 43111 FlyBaseID:FBgn0039367 Length:290 Species:Drosophila melanogaster
Sequence 2:XP_038966311.1 Gene:Zdhhc18 / 362613 RGDID:1309334 Length:482 Species:Rattus norvegicus


Alignment Length:276 Identity:59/276 - (21%)
Similarity:96/276 - (34%) Gaps:80/276 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 VLFVIVTTIFFVVLQMFYV-------VPQLFDVQGFMYKLGWLVAIFITYNIFGNMLACHIT--- 82
            :|.::.|||.|.:....|:       :|.:..:..|......|...|....|......|...   
  Rat    96 LLLILSTTILFFIFDCPYLARTLTLAIPIIAAILFFFVMSCLLQTSFTDPGILPRATICEAAALE 160

  Fly    83 -------STSVESLPKDRQIPEPEEEHQWHYCDVCEKLMPPRSWHCILCKCCILKRDRHCIFTAS 140
                   |::....|:.|::....:..:..||..|:...|||:.||.:|..|:.:.|.||.:..:
  Rat   161 KQIDNTGSSTYRPPPRTREVMINGQMVKLKYCFTCKMFRPPRTSHCSVCDNCVERFDHHCPWVGN 225

  Fly   141 CVGHNNQRYFFWFTLFMALGTGVALATHIIATLKYFSYSDLIFLNIPRDNLPPFWLVITLILNTY 205
            |||..|.|:|:.|.|.::                                          .|..:
  Rat   226 CVGRRNYRFFYAFILSLS------------------------------------------FLTAF 248

  Fly   206 VFAAPVS--SVLMQ----LSVLKNNGTLHKFYSDTYDL-----GLWENFKLILGGKGFWTFLSPT 259
            :||..|:  ::|.|    ||.||      |..:...:|     .:|.    |||..||.|:|..:
  Rat   249 IFACVVTHLTLLSQGSNFLSALK------KTPASVLELVICFFSIWS----ILGLSGFHTYLVAS 303

  Fly   260 VKSPLPHDGAQWKIKR 275
            ..:........|..||
  Rat   304 NLTTNEDIKGSWSSKR 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17197NP_651425.2 PHA02688 <9..70 CDD:222919 10/48 (21%)
zf-DHHC 100..>198 CDD:279823 21/97 (22%)
Zdhhc18XP_038966311.1 DHHC 189..312 CDD:396215 41/174 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.