DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17197 and CG1407

DIOPT Version :9

Sequence 1:NP_651425.2 Gene:CG17197 / 43111 FlyBaseID:FBgn0039367 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001286264.1 Gene:CG1407 / 36043 FlyBaseID:FBgn0033474 Length:452 Species:Drosophila melanogaster


Alignment Length:339 Identity:72/339 - (21%)
Similarity:118/339 - (34%) Gaps:107/339 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 VLFVIVTTIFFVVLQMFYVVPQLFDVQGFMYKLGWLVAIFITYNIFGNMLACHITS------TSV 86
            |||:..     |:...:|.......::....::| ::.:.:.|::|   |...:.|      |||
  Fly    25 VLFITA-----VIAWSYYAYVVELCIRNSENRIG-MIFMLLFYHLF---LTLFMWSYWRTIMTSV 80

  Fly    87 ESLPKDRQIPEPEEEHQW------------------------------HYCDVCEKLMPPRSWHC 121
            ..:|...:||:.|....:                              .:|:.|:.:.|.|:.||
  Fly    81 GRIPDQWRIPDEEVSRLFRADSPDTQKRILNNFARDLPVTNRTMNGSVRFCEKCKIIKPDRAHHC 145

  Fly   122 ILCKCCILKRDRHCIFTASCVGHNNQRYFFWFTLFMALGTGVALATHIIATLKYFSYSDLIFLNI 186
            .:|.||:||.|.||.:..:||...|.:||..|     ||..:....::..|    |..|.:    
  Fly   146 SVCSCCVLKMDHHCPWVNNCVNFYNYKYFVLF-----LGYALVYCLYVAFT----SLHDFV---- 197

  Fly   187 PRDNLPPFWLVITLILNTY------------------VFAAPVSSVLMQLS--------VLKNNG 225
                  .||.|.....|.|                  :|...:...:..:|        ||.|..
  Fly   198 ------EFWKVGAYDNNGYSAQGQLNASGMGRFHILFLFFIAIMFAISLVSLFGYHIYLVLVNRT 256

  Fly   226 TLHKFYS----------DTYDLGLWENFKLILGGKGFWTFLSPTVKSPLPHDGAQWKI----KRV 276
            ||..|.:          :.|:||.:.||..:.|....:.|| |...|  ..||..:..    .||
  Fly   257 TLESFRAPIFRVGGPDKNGYNLGRYANFCEVFGDDWQYWFL-PVFSS--RGDGYSYPTSSDQSRV 318

  Fly   277 QHHSPKLQFLRVSD 290
            ...||..::..:.|
  Fly   319 STSSPTQRYDAMGD 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17197NP_651425.2 PHA02688 <9..70 CDD:222919 6/41 (15%)
zf-DHHC 100..>198 CDD:279823 27/127 (21%)
CG1407NP_001286264.1 zf-DHHC 129..259 CDD:279823 36/148 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467479
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.