DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17197 and spe-10

DIOPT Version :9

Sequence 1:NP_651425.2 Gene:CG17197 / 43111 FlyBaseID:FBgn0039367 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001021339.1 Gene:spe-10 / 3565514 WormBaseID:WBGene00004964 Length:351 Species:Caenorhabditis elegans


Alignment Length:342 Identity:77/342 - (22%)
Similarity:140/342 - (40%) Gaps:82/342 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WACTKYLARRNPKIFVR--ISHPTAVLFVIVTTIFFV---VLQMFYVVPQLFDVQGFMYKLG-WL 63
            |..|:.|   |..:|::  :...:..::|.||..::|   :....|::     |..|::.:. |.
 Worm    23 WILTRCL---NVLLFIQLILLWWSLYMYVTVTIGYYVQSTIQATIYLI-----VGSFLFVMSMWS 79

  Fly    64 VAIFITYNIFGNMLACHITSTSVES-------LPKDRQIPE---PEE--------EHQWHYCDV- 109
            :|..: :...|.:...:..|..:|.       :.|:|.:.|   ||:        |....||.| 
 Worm    80 LAKTL-FTRVGRVPERYRPSKELEDRLKAVTPMEKNRYVVEKSTPEQLAQQNTILEEMCTYCKVV 143

  Fly   110 ---------------CEKLMPPRSWHCILC-KCCILKRDRHCIFTASCVGHNNQRYFFWFTLFMA 158
                           |..:.|.|:.||..| |||| |.|.||.:...||.|.|.:||..:.::.:
 Worm   144 VAECDQVGRLKYCYECGHIKPDRARHCSSCGKCCI-KYDHHCPWINMCVTHVNYKYFLLYIIYTS 207

  Fly   159 LGTGVALATHIIATLKYF---SYSD-----LIFLNIPRDNLPPFWLVITLILNTY------VFAA 209
            ......|.|.:...::||   .::|     |.:|         |..::..:...|      :|..
 Worm   208 FLVYWYLLTSLEGAVRYFINQQWTDELGKFLFYL---------FSFIVGGVFGYYPLGELIIFHY 263

  Fly   210 PVSSVLMQLSVLKNNGTLHKF-YSDTYDLGLWENFKLILGGKGFWTFLSPTVKSPLPHDGAQWKI 273
            .:.| |.:.:|.:....|.:| .:..|::|.:.||:.:.|. |.|  |.|...|  ..||..:.|
 Worm   264 QLIS-LNETTVEQTKPALLRFDNAADYNMGKYNNFQSVFGW-GLW--LCPIDSS--TQDGLHFDI 322

  Fly   274 KRVQHHSPKLQFLRVSD 290
            :.| :...:.:|:|:.:
 Worm   323 RYV-NTQQRNRFVRIEE 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17197NP_651425.2 PHA02688 <9..70 CDD:222919 12/66 (18%)
zf-DHHC 100..>198 CDD:279823 32/130 (25%)
spe-10NP_001021339.1 zf-DHHC 151..277 CDD:279823 33/136 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.