DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17197 and Dnz1

DIOPT Version :9

Sequence 1:NP_651425.2 Gene:CG17197 / 43111 FlyBaseID:FBgn0039367 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_477449.1 Gene:Dnz1 / 34503 FlyBaseID:FBgn0027453 Length:276 Species:Drosophila melanogaster


Alignment Length:242 Identity:62/242 - (25%)
Similarity:104/242 - (42%) Gaps:45/242 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 VLFVIVTTIFFVVLQMFYVVPQLFDVQGFMYKLGWLVAIFI---TYNIFGNML---ACHITSTSV 86
            :.::|:||:...:...|:||  ||:...|:..:....|:|.   |..:..|.|   ..|.|    
  Fly    28 IRWIILTTMPGSLWMSFHVV--LFNTVVFLLAMSHSKAVFSDPGTVPLPANRLDFSDLHTT---- 86

  Fly    87 ESLPKDRQIPEPEEEH--QWHYCDVCEKLMPPRSWHCILCKCCILKRDRHCIFTASCVGHNNQRY 149
                 ::..|.|...|  :|..|..||...|||:.||.:||.||.:.|.||.:..:|||..||:|
  Fly    87 -----NKNNPPPGNGHSSEWTVCTRCETYRPPRAHHCRICKRCIRRMDHHCPWINNCVGERNQKY 146

  Fly   150 FFWFTLFMALGT--GVAL------------ATHIIATLKYFSYSDLIFLNIPRDNLPPFWLVITL 200
            |..|.:::||.:  .:||            :.::|.|.....:|.::.|....     |.|.:|.
  Fly   147 FLQFLIYVALLSLYSIALIVGSWVWPCEECSQNVIETQLRMIHSVILMLVSAL-----FGLFVTA 206

  Fly   201 I----LNTYVFAAPVSSVLMQLSVLKNNGTLHKFYSDTYDLG---LW 240
            |    |:..::.......:.|....:.|...::..:|.:..|   ||
  Fly   207 IMVDQLHAILYDETAVEAIQQKGTYRPNRRKYQLLADVFGRGHPALW 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17197NP_651425.2 PHA02688 <9..70 CDD:222919 11/44 (25%)
zf-DHHC 100..>198 CDD:279823 35/113 (31%)
Dnz1NP_477449.1 DHHC 97..228 CDD:396215 38/135 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467572
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.