DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17197 and ZDHHC21

DIOPT Version :9

Sequence 1:NP_651425.2 Gene:CG17197 / 43111 FlyBaseID:FBgn0039367 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001341047.1 Gene:ZDHHC21 / 340481 HGNCID:20750 Length:265 Species:Homo sapiens


Alignment Length:268 Identity:66/268 - (24%)
Similarity:108/268 - (40%) Gaps:51/268 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 IFFVVLQMFYVVPQ--LFDVQGFMYKLGWLVAIFITYNIFGNMLACHITSTSVESLPKDRQIPEP 98
            |.||.|....::|:  ||......:..|.|:.||...:||..:.....:.|....||::.:||..
Human    20 IVFVWLYNIVLIPKIVLFPHYEEGHIPGILIIIFYGISIFCLVALVRASITDPGRLPENPKIPHG 84

  Fly    99 EEEHQWHYCDVCEKLMPPRSWHCILCKCCILKRDRHCIFTASCVGHNNQRYFFWFTLFMALGTGV 163
            |.|. |..|:.|..:.|.||.||..|..|:.:.|.||.:..:|||.:|...|.....:..|.|..
Human    85 EREF-WELCNKCNLMRPKRSHHCSRCGHCVRRMDHHCPWINNCVGEDNHWLFLQLCFYTELLTCY 148

  Fly   164 ALATHIIATLKYFSYSD-LIFLNIPRDNLPPF-------------WLVITLILN-TYVFAAPVSS 213
            ||         .||:.. ..||.:.:.||..|             ::.||:::. |.:|...:  
Human   149 AL---------MFSFCHYYYFLPLKKRNLDLFVFRHELAIMRLAAFMGITMLVGITGLFYTQL-- 202

  Fly   214 VLMQLSVLKNNGTLHKFYSDTYDLGL----W-ENFKLILG--GKGFWTFLSPTVKSPLPHDGAQW 271
                :.::.:..::.|..:...|:..    | :.|..:.|  .|..| |:....:.||       
Human   203 ----IGIITDTTSIEKMSNCCEDISRPRKPWQQTFSEVFGTRWKILW-FIPFRQRQPL------- 255

  Fly   272 KIKRVQHH 279
               ||.:|
Human   256 ---RVPYH 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17197NP_651425.2 PHA02688 <9..70 CDD:222919 11/35 (31%)
zf-DHHC 100..>198 CDD:279823 30/111 (27%)
ZDHHC21NP_001341047.1 DHHC 92..217 CDD:396215 33/139 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.