DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17197 and Zdhhc23

DIOPT Version :9

Sequence 1:NP_651425.2 Gene:CG17197 / 43111 FlyBaseID:FBgn0039367 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001007461.1 Gene:Zdhhc23 / 332175 MGIID:2685625 Length:425 Species:Mus musculus


Alignment Length:308 Identity:58/308 - (18%)
Similarity:109/308 - (35%) Gaps:115/308 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 KIFVRISHPTAVL--------------FVIVTTIFFVVLQMFYVVPQ-----LFDVQGFMYKLGW 62
            |:.:.|..|..:|              .|::|::..:.|..:|:..:     ||.:...::.||:
Mouse    81 KVNISIVPPLVLLPVFLHVASWHFLLGVVVLTSLPMLALWYYYLTHRRKEQTLFFLSLGLFSLGY 145

  Fly    63 LVAIF-----------------ITYNIFGNMLACHITS-----TSVESLPKDRQIPEPEEEHQ-- 103
            :..:|                 :|..:...:||.:...     .|.:..|.:.||..|.::.|  
Mouse   146 MYYVFLREVVPQGRVGPTQLALLTCGLLLILLALYRAKKNPGYLSNDKSPSNSQIECPVKKGQEK 210

  Fly   104 ---------------------------------------WHYCDVCEKLMPPRSWHCILCKCCIL 129
                                                   |  |..|:.:.|.|:|||.:|..|:.
Mouse   211 TKGFPGTDASGSLNNRTLKDDVRGSSRVGLDSPAKVKEDW--CAKCQLVRPARAWHCRICGICVR 273

  Fly   130 KRDRHCIFTASCVGH-NNQRYFFWFTLFMALGT-GVALATHIIATLK------------YFSYSD 180
            :.|.||::..||||. |:|.:....::|:.... |::|..:.|...:            |.:||.
Mouse   274 RMDHHCVWINSCVGESNHQAFILALSIFLLTSVYGISLTLNTICRDRSLFTALFYCPGVYANYSS 338

  Fly   181 LIFLNIPRDNLPPFW--LVITLILNTYVFAAPVSSVLMQLSVLKNNGT 226
            .:       :....|  ::||..: .|:|       |:||..:..|.|
Mouse   339 AL-------SFTCVWYSVIITAGM-AYIF-------LIQLINISYNVT 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17197NP_651425.2 PHA02688 <9..70 CDD:222919 13/88 (15%)
zf-DHHC 100..>198 CDD:279823 28/154 (18%)
Zdhhc23NP_001007461.1 DHHC 248..374 CDD:396215 36/141 (26%)
Interaction with NOS1. /evidence=ECO:0000250 422..425
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.