DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17197 and CG17075

DIOPT Version :9

Sequence 1:NP_651425.2 Gene:CG17197 / 43111 FlyBaseID:FBgn0039367 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001245821.1 Gene:CG17075 / 33191 FlyBaseID:FBgn0031239 Length:968 Species:Drosophila melanogaster


Alignment Length:280 Identity:58/280 - (20%)
Similarity:102/280 - (36%) Gaps:77/280 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 HPTAVLFVIVTTIFFVVLQMFYVVPQLFD--VQGFMYKLGWLVAIFITYNIFGNMLACHITSTSV 86
            ||..:...:|..:|.|.  .::|:...|.  :||.:|  |.:..:::.:      :|.|:|:...
  Fly   111 HPLQIFGWLVLLLFGVA--SYWVLIPAFHARIQGPLY--GLITGLYLVH------IASHLTALLT 165

  Fly    87 ESLPK--------DRQIPEPEEEHQWHY-----CDVCE-KLMPPRSWHCILCKCCILKRDRHCIF 137
            :...|        ||.:||.:.....|.     |.:|. :....|:.||.:|..|:.|.|.||.:
  Fly   166 DPADKELRRVHRNDRIVPEFDRSKHSHVIENGRCHLCNIRTSSNRTKHCSVCNKCVGKFDHHCKW 230

  Fly   138 TASCVGHNNQRYFFWFTLFMALGTGVALATHIIATLKYFSYSDLIFLNIPRDNLPPFWLVITLIL 202
            ...|:|..|      :..|:.......:||.:|...   ..:.::|..|..|.|..:|       
  Fly   231 LNHCIGSRN------YVAFLMCVVSAVVATLVIVAA---VVAQIVFYYIQPDWLSFYW------- 279

  Fly   203 NTYVFAAPVSSV-------LMQLSVLKNNGTL-----HKFYSDTYDLGLW--------------- 240
                  .|..|.       .:.:::..:|||:     |....|.:. .:|               
  Fly   280 ------CPTESSHTIESGDFINITLSLSNGTMMLIEQHTSEEDVHQ-EMWDEEQANMTISTLPTL 337

  Fly   241 -ENFKLILGGKGFWTFLSPT 259
             |||..|:........:|||
  Fly   338 LENFTAIIEASATRPGISPT 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17197NP_651425.2 PHA02688 <9..70 CDD:222919 11/47 (23%)
zf-DHHC 100..>198 CDD:279823 24/103 (23%)
CG17075NP_001245821.1 zf-DHHC 199..>282 CDD:279823 23/104 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22883
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.