DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17197 and Zdhhc20

DIOPT Version :9

Sequence 1:NP_651425.2 Gene:CG17197 / 43111 FlyBaseID:FBgn0039367 Length:290 Species:Drosophila melanogaster
Sequence 2:XP_006252134.1 Gene:Zdhhc20 / 305923 RGDID:1305755 Length:444 Species:Rattus norvegicus


Alignment Length:338 Identity:69/338 - (20%)
Similarity:117/338 - (34%) Gaps:117/338 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IWACTKYLARRNPKIFVRISHPTAVLFVIV-----------------------TTIFFVVLQMFY 45
            :|.|.:.:....|.:|        :.||:|                       |.::.|...:|:
  Rat    65 LWRCCQRVVGWVPVLF--------ITFVVVWSYYAYVVELCVSTVSRTGEKGKTVVYLVAFHLFF 121

  Fly    46 VVPQLFDVQGFMYKLGWLVAIFITYNIFGNMLACHITSTS-------VESLPKDRQIPEPEEEHQ 103
            |          |:...:.:.||              ||.:       :.:..|:|...|..:|.|
  Rat   122 V----------MFVWSYWMTIF--------------TSPASPSKEFYLSNSEKERYEKEFSQERQ 162

  Fly   104 W---------------------HYCDVCEKLMPPRSWHCILCKCCILKRDRHCIFTASCVGHNNQ 147
            .                     .||:.|:.:.|.|:.||..|..|:||.|.||.:..:|||..|.
  Rat   163 QDILRRAARDLPVYTTSASKAIRYCEKCQLIKPDRAHHCSACDRCVLKMDHHCPWVNNCVGFTNY 227

  Fly   148 RYFFWFTLFMALGTGVALATHIIATLKYFSY-----------SDLIFLNIPRDNLP--PFWLVIT 199
            ::|..|.|:..|......||.:...:|:::.           ::...|..|....|  .|.::..
  Rat   228 KFFMLFLLYSLLYCLFVAATVLEYFIKFWTLCRRKSTENCPKNEPTVLTFPSAKFPSAKFHVLFL 292

  Fly   200 LILNTYVFAAPVSSVLMQLS-----VLKNNGTLHKFYS---------DTYDLGLWENFKLILGG- 249
            ..::...|.    |||...|     |.||..|:..|.:         :.:.||..:|::.:.|. 
  Rat   293 FFVSAMFFV----SVLSLFSYHCWLVGKNRTTIESFRAPMFSYGIDGNGFSLGCSKNWRQVFGDE 353

  Fly   250 KGFWTFLSPTVKS 262
            |.:|  |.|...|
  Rat   354 KKYW--LVPIFSS 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17197NP_651425.2 PHA02688 <9..70 CDD:222919 12/83 (14%)
zf-DHHC 100..>198 CDD:279823 31/131 (24%)
Zdhhc20XP_006252134.1 zf-DHHC 75..380 CDD:303066 67/328 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.