DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17197 and Zdhhc8

DIOPT Version :9

Sequence 1:NP_651425.2 Gene:CG17197 / 43111 FlyBaseID:FBgn0039367 Length:290 Species:Drosophila melanogaster
Sequence 2:XP_006248672.1 Gene:Zdhhc8 / 303796 RGDID:1308875 Length:775 Species:Rattus norvegicus


Alignment Length:225 Identity:56/225 - (24%)
Similarity:86/225 - (38%) Gaps:61/225 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 RRNPKIFVRISHPTAVLFVIVTTIFFVVLQMFYVVPQLFDVQGFMYKLGWLV-----AIFITYN- 71
            |..|..::.:: ..|.|.|..:|:|||     :..|             ||.     ||.: || 
  Rat     8 RLKPAKYIPVA-TAAALLVGSSTLFFV-----FTCP-------------WLTRAVSPAIPV-YNG 52

  Fly    72 -IFGNMLACHITSTSVES--LPKDRQIPEPEEEH---------------QWHYCDVCEKLMPPRS 118
             :|..:||....:|.::.  .|:..:..:.|::.               :..:|..|....|||.
  Rat    53 ILFLFVLANFSMATFMDPGVFPRADEDEDKEDDFRAPLYKNVDVRGIQVRMKWCATCHFYRPPRC 117

  Fly   119 WHCILCKCCILKRDRHCIFTASCVGHNNQRYFFWFTL--------FMALGTGVAL-------ATH 168
            .||.:|..|:...|.||.:..:|:|..|.||||.|.|        .:|.|....|       |.|
  Rat   118 SHCSVCDNCVEDFDHHCPWVNNCIGRRNYRYFFLFLLSLSAHMVGVVAFGLLYVLNHSEGLGAAH 182

  Fly   169 IIATLKYFSYSDLIFLNIPRDNLPPFWLVI 198
            ...|:.....:.|.|  ||...|..|.:|:
  Rat   183 TTITMAVMCVAGLFF--IPVIGLTGFHVVL 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17197NP_651425.2 PHA02688 <9..70 CDD:222919 14/61 (23%)
zf-DHHC 100..>198 CDD:279823 33/127 (26%)
Zdhhc8XP_006248672.1 zf-DHHC 99..224 CDD:279823 34/114 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.