DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17197 and Zdhhc3

DIOPT Version :9

Sequence 1:NP_651425.2 Gene:CG17197 / 43111 FlyBaseID:FBgn0039367 Length:290 Species:Drosophila melanogaster
Sequence 2:XP_038937239.1 Gene:Zdhhc3 / 301081 RGDID:1309041 Length:350 Species:Rattus norvegicus


Alignment Length:264 Identity:67/264 - (25%)
Similarity:107/264 - (40%) Gaps:52/264 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 IVTTIFFVVLQMFYVV--PQLFDVQGFMYKLGWLVAIFITYNIFGNMLA-------CHITSTSVE 87
            |||  :|:||...:||  ..|...:.:.|.        |...|..|:||       |....|...
  Rat    49 IVT--WFLVLYAEFVVLFVMLIPSRDYAYS--------IINGIVFNLLAFLALASHCRAMLTDPG 103

  Fly    88 SLPKDRQIPEPEEEHQW------HYCDVCEKLMPPRSWHCILCKCCILKRDRHCIFTASCVGHNN 146
            ::||.....|..|..|.      :.|..|..:.|.|:.||.:||.||.|.|.||.:..:|||.||
  Rat   104 AVPKGNATKEFIESLQLKPGQVVYKCPKCCSIKPDRAHHCSVCKRCIRKMDHHCPWVNNCVGENN 168

  Fly   147 QRYFFWFTLFMALGTGVALATHIIATLKY---------------FSYSDLIFLNIPRDNLPPFWL 196
            |:||..||:::||     ::.|.:..:.:               ||....:.|.|    |..|..
  Rat   169 QKYFVLFTMYIAL-----ISLHALIMVGFHFLHCFEEDWTKCSSFSPPTTVILLI----LLCFEA 224

  Fly   197 VITLILNTYVFAAPVSSVLMQLSVLKNNGTLHKFYSDTYDLGLWENFKLILGGKGFWTFLSPTVK 261
            ::.||..:.:|...|.|:....:.::.   |.:........|.|::.:...||:....:.:|..:
  Rat   225 LLFLIFTSVMFGTQVHSICTDETGIER---LQRSKQPREQSGSWKSVQEAFGGEFSLNWFNPFTR 286

  Fly   262 SPLP 265
            ...|
  Rat   287 PCQP 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17197NP_651425.2 PHA02688 <9..70 CDD:222919 11/39 (28%)
zf-DHHC 100..>198 CDD:279823 35/118 (30%)
Zdhhc3XP_038937239.1 DHHC 128..253 CDD:396215 38/136 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.