DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17197 and Zdhhc22

DIOPT Version :9

Sequence 1:NP_651425.2 Gene:CG17197 / 43111 FlyBaseID:FBgn0039367 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001034414.1 Gene:Zdhhc22 / 299211 RGDID:1308446 Length:263 Species:Rattus norvegicus


Alignment Length:222 Identity:51/222 - (22%)
Similarity:87/222 - (39%) Gaps:63/222 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 VRISHPTAVLFVIVTTIFFVVLQMFYVVPQLFD------------VQGFMYKLGWLVAIFITYNI 72
            :|:.:..|..:.:..::...|||:|..:|.:.:            :.|.::       :|::.|.
  Rat     4 LRLLNVVAPAYFLCISLVTFVLQLFLFLPSMREDPTATPLFSPAVLHGALF-------LFLSANA 61

  Fly    73 FGNML-----------ACHITSTSVESLPKDRQIPEPEEEHQWHYCDVCEKLMPPRSWHCILCKC 126
            .||.:           ||..||:      :..|.|.|..    |:|.||.::             
  Rat    62 LGNYILVVQNSPDDLGACQGTSS------QRPQRPPPST----HFCRVCARV------------- 103

  Fly   127 CILKRDRHCIFTASCVGHNNQRYFFWFTLFMALG---TGVALATHIIATLKYFSYSDLIFLNIPR 188
             .|:.|.||.||.:|:|..|.|.|..|.|:.:|.   :.||...:|.|.|.......|.||.:..
  Rat   104 -TLRHDHHCFFTGNCIGSRNMRNFILFCLYTSLACLYSMVAGVAYISAVLSISFAHPLAFLTLLP 167

  Fly   189 DNLPPFWLVITL------ILNTYVFAA 209
            .::..|:....|      ||..|::.|
  Rat   168 TSISQFFSGAVLGSDMFVILMLYLWFA 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17197NP_651425.2 PHA02688 <9..70 CDD:222919 9/61 (15%)
zf-DHHC 100..>198 CDD:279823 27/100 (27%)
Zdhhc22NP_001034414.1 DHHC 91..218 CDD:396215 33/122 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22883
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.