DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17197 and Zdhhc19

DIOPT Version :9

Sequence 1:NP_651425.2 Gene:CG17197 / 43111 FlyBaseID:FBgn0039367 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001034348.1 Gene:Zdhhc19 / 288045 RGDID:1309014 Length:359 Species:Rattus norvegicus


Alignment Length:310 Identity:72/310 - (23%)
Similarity:117/310 - (37%) Gaps:80/310 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PTAVLFVIVTTIFFVVLQMFYVVPQLFDVQGFMYKLGWLV------------AIFITYNIFGNML 77
            |.:..|..:...|.|.|.:|  :..||    |.:...|||            .:||.  .|.:::
  Rat    24 PLSWFFPSLFAAFNVSLLVF--LSGLF----FGFPCRWLVQNGEWVFPAVTGPLFIL--TFFSLV 80

  Fly    78 ACHITSTSVESLPKDRQIPEPEEEH-----------QWHYCDVCEKLMPPRSWHCILCKCCILKR 131
            :.:.:...:  |.:.....:|...|           :|  |..|....|||::||..|..|:...
  Rat    81 SLNFSDPGI--LHRGSVSEDPRTVHVVRVNQRAFRLEW--CPKCLFHRPPRTYHCPWCNICVEDF 141

  Fly   132 DRHCIFTASCVGHNNQRYFFWFTLFMALGTGVALATHIIATLKYFSYSDLIFLNIPRDNLPPFWL 196
            |.||.:..:|:||.|.|.|....||:.|.:|..|.|            .|:|| |...:| ||.|
  Rat   142 DHHCKWVNNCIGHRNFRLFVLLILFLCLYSGALLVT------------CLMFL-IHTSHL-PFSL 192

  Fly   197 VITLILNTYVFAAPVSSVLMQLSVLKNNGTL---------------HKFYSDTYDLGLWENFKLI 246
            ...:.:   :.|.|.:..|:.|.:|.....|               |:.| :.:|.|..:|:.|.
  Rat   193 DKAMAI---LVAVPAAGFLIPLFLLMLIQALSVSRAERSYESKCRDHEEY-NPFDQGFAKNWYLT 253

  Fly   247 LGGKGFWTFLSPTV--KSPLPHDGAQWKIKRVQ----------HHSPKLQ 284
            :.......::|..|  :.|:..:..|.|.|...          |..|::|
  Rat   254 MCAPLGPNYMSEVVCLQRPVGTERIQEKTKHPPPCPPKPCGPGHPGPQIQ 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17197NP_651425.2 PHA02688 <9..70 CDD:222919 14/56 (25%)
zf-DHHC 100..>198 CDD:279823 34/108 (31%)
Zdhhc19NP_001034348.1 zf-DHHC 112..230 CDD:279823 39/136 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.