DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17197 and ZDHHC24

DIOPT Version :9

Sequence 1:NP_651425.2 Gene:CG17197 / 43111 FlyBaseID:FBgn0039367 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_997223.1 Gene:ZDHHC24 / 254359 HGNCID:27387 Length:284 Species:Homo sapiens


Alignment Length:184 Identity:57/184 - (30%)
Similarity:81/184 - (44%) Gaps:25/184 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 WHYCDVCEKLMPPRSWHCILCKCCILKRDRHCIFTASCVGHNNQRYFFWFTLFMA---LGTGVAL 165
            |.||..|:..:||||.||..|:.|||:||.||.....|||..|.|.|....|..|   |...|.|
Human    93 WAYCYQCQSQVPPRSGHCSACRVCILRRDHHCRLLGRCVGFGNYRPFLCLLLHAAGVLLHVSVLL 157

  Fly   166 ATHIIATLKYFSYSDLIFLNIPRDNLPPFWLV------------ITLILNTYVFAAPV--SSVLM 216
            ...:.|.|:..:...:..|.:    ||  ||:            :..:.:|.|..|.:  :.:|.
Human   158 GPALSALLRAHTPLHMAALLL----LP--WLMLLTGRVSLAQFALAFVTDTCVAGALLCGAGLLF 216

  Fly   217 QLSVLKNNGTLHKFY--SDTYDLGLWENFKLILGGKGFWTFLSPTVKSPLPHDG 268
            ...:|....|..::.  ..:||||...|.:..||.:....:|.|.:.||||.||
Human   217 HGMLLLRGQTTWEWARGQHSYDLGPCHNLQAALGPRWALVWLWPFLASPLPGDG 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17197NP_651425.2 PHA02688 <9..70 CDD:222919
zf-DHHC 100..>198 CDD:279823 36/108 (33%)
ZDHHC24NP_997223.1 zf-DHHC 95..234 CDD:279823 41/144 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 74 1.000 Domainoid score I9123
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 116 1.000 Inparanoid score I4820
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG47998
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002152
OrthoInspector 1 1.000 - - otm40467
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1251
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.830

Return to query results.
Submit another query.