Sequence 1: | NP_651425.2 | Gene: | CG17197 / 43111 | FlyBaseID: | FBgn0039367 | Length: | 290 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001316988.1 | Gene: | ZDHHC20 / 253832 | HGNCID: | 20749 | Length: | 365 | Species: | Homo sapiens |
Alignment Length: | 285 | Identity: | 69/285 - (24%) |
---|---|---|---|
Similarity: | 105/285 - (36%) | Gaps: | 95/285 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 60 LGWLVAIFIT----------------YNIFGN---------MLACHI--------------TSTS 85
Fly 86 -------VESLPKDRQIPEPEEEHQW---------------------HYCDVCEKLMPPRSWHCI 122
Fly 123 LCKCCILKRDRHCIFTASCVGHNNQRYFFWFTLFMALGTGVALATHIIATLKYFSYSDLIFLNIP 187
Fly 188 RDNLPPFWLVITLILNTYVFAAPVSSVLMQLS-----VLKNNGTLHKFYSDT---------YDLG 238
Fly 239 LWENFKLILGG-KGFWTFLSPTVKS 262 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17197 | NP_651425.2 | PHA02688 | <9..70 | CDD:222919 | 5/25 (20%) |
zf-DHHC | 100..>198 | CDD:279823 | 33/118 (28%) | ||
ZDHHC20 | NP_001316988.1 | zf-DHHC | 16..301 | CDD:327686 | 68/283 (24%) |
Substrate binding. /evidence=ECO:0000305|PubMed:29326245 | 140..143 | 1/2 (50%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5273 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |