DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17197 and ZDHHC20

DIOPT Version :9

Sequence 1:NP_651425.2 Gene:CG17197 / 43111 FlyBaseID:FBgn0039367 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001316988.1 Gene:ZDHHC20 / 253832 HGNCID:20749 Length:365 Species:Homo sapiens


Alignment Length:285 Identity:69/285 - (24%)
Similarity:105/285 - (36%) Gaps:95/285 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 LGWLVAIFIT----------------YNIFGN---------MLACHI--------------TSTS 85
            :||:..:|||                :.||||         ::|.|:              ||.:
Human    14 VGWVPVLFITFVVVWSYYAYVVELCVFTIFGNEENGKTVVYLVAFHLFFVMFVWSYWMTIFTSPA 78

  Fly    86 -------VESLPKDRQIPEPEEEHQW---------------------HYCDVCEKLMPPRSWHCI 122
                   :.:..|:|...|..:|.|.                     .||:.|:.:.|.|:.||.
Human    79 SPSKEFYLSNSEKERYEKEFSQERQQEILRRAARALPIYTTSASKTIRYCEKCQLIKPDRAHHCS 143

  Fly   123 LCKCCILKRDRHCIFTASCVGHNNQRYFFWFTLFMALGTGVALATHIIATLKYFSYSDLIFLNIP 187
            .|..||||.|.||.:..:|||.:|.::|..|.|:..|......||    .|:||.   ..:.|..
Human   144 ACDSCILKMDHHCPWVNNCVGFSNYKFFLLFLLYSLLYCLFVAAT----VLEYFI---KFWTNEL 201

  Fly   188 RDNLPPFWLVITLILNTYVFAAPVSSVLMQLS-----VLKNNGTLHKFYSDT---------YDLG 238
            .|....|.::....::...|.    |||...|     |.||..|:..|.:.|         :.||
Human   202 TDTRAKFHVLFLFFVSAMFFI----SVLSLFSYHCWLVGKNRTTIESFRAPTFSYGPDGNGFSLG 262

  Fly   239 LWENFKLILGG-KGFWTFLSPTVKS 262
            ..:|::.:.|. |.:|  |.|...|
Human   263 CSKNWRQVFGDEKKYW--LLPIFSS 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17197NP_651425.2 PHA02688 <9..70 CDD:222919 5/25 (20%)
zf-DHHC 100..>198 CDD:279823 33/118 (28%)
ZDHHC20NP_001316988.1 zf-DHHC 16..301 CDD:327686 68/283 (24%)
Substrate binding. /evidence=ECO:0000305|PubMed:29326245 140..143 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.