DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17197 and Zdhhc19

DIOPT Version :9

Sequence 1:NP_651425.2 Gene:CG17197 / 43111 FlyBaseID:FBgn0039367 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_955013.1 Gene:Zdhhc19 / 245308 MGIID:2682948 Length:347 Species:Mus musculus


Alignment Length:291 Identity:61/291 - (20%)
Similarity:112/291 - (38%) Gaps:64/291 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PTAVLFVIVTTIFFVVLQMFYVVPQLFDVQGFMYKLGWLV------------AIFITYNIFGNML 77
            |::|......|:...:..:|:         ||..:  |||            .:||.  .|.:::
Mouse    26 PSSVFAAFNVTLLLFLSGLFF---------GFPCR--WLVQNGEWAFPAITGPLFIL--TFFSLV 77

  Fly    78 ACHITSTSVESLPKDRQIPEPEEEH-----------QWHYCDVCEKLMPPRSWHCILCKCCILKR 131
            :.:.:...:  |.:.....:|...|           :|  |..|....|||::||..|..|:...
Mouse    78 SLNFSDPGI--LHRGSTKEDPMTVHVVRVNQRAFRLEW--CPKCLFHRPPRTYHCPWCNICVEDF 138

  Fly   132 DRHCIFTASCVGHNNQRYFFWFTLFMALGTGVALATHI--IATLKYFSYS----DLIFLNIPRDN 190
            |.||.:..:|:||.|.|.|....|.:.|.:|..|.|.:  :...::..:|    ..|.:.:|...
Mouse   139 DHHCKWVNNCIGHRNFRLFMLLVLSLCLYSGALLVTCLTFLFRTRHLPFSLDKGMAILVAVPAAG 203

  Fly   191 --LPPFWLVITLILNTYVFAAPVSSVLMQLSVLKNNGTLHKFYSDTYDLGLWENFKLILGGKGFW 253
              :|.|.|::...|          ||....|..::....|..| :.:|.|..:|:.|.:......
Mouse   204 FLIPLFLLLLIQAL----------SVSRAESSYESKCRYHPEY-NPFDQGFAKNWYLAMFAPLGP 257

  Fly   254 TFLSPTV--KSPLPHDGAQWKIKRVQHHSPK 282
            .::|..|  :.|:   |..|..::.:...|:
Mouse   258 NYMSEVVCLQRPV---GTAWIQEKTKPSPPR 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17197NP_651425.2 PHA02688 <9..70 CDD:222919 11/56 (20%)
zf-DHHC 100..>198 CDD:279823 31/116 (27%)
Zdhhc19NP_955013.1 DHHC 109..>181 CDD:366691 24/73 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 275..347 1/11 (9%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.