DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17197 and Zdhhc13

DIOPT Version :9

Sequence 1:NP_651425.2 Gene:CG17197 / 43111 FlyBaseID:FBgn0039367 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_082307.1 Gene:Zdhhc13 / 243983 MGIID:1919227 Length:622 Species:Mus musculus


Alignment Length:288 Identity:62/288 - (21%)
Similarity:108/288 - (37%) Gaps:73/288 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 CLIWACTKYLARRNPKIFVRISH----PTAVLFVIVTTIFFVVLQMFYVVPQLF--DVQGFMYKL 60
            ||:.|.. :|....|:..|...:    ||..|   :::||::.:..|.    ||  |..|.....
Mouse   322 CLLVALF-FLTSLFPRFLVGYKNLVYLPTVFL---LSSIFWIFMTWFI----LFFPDTAGSPLYF 378

  Fly    61 GWLVAIFITYNIFGNMLACHITSTSVESLPKDRQIPEPEEEHQWH--------------YCDVCE 111
            .::.:|......|....|.....|...           |||.:.:              :|..|.
Mouse   379 AFIFSIMAFLYFFYKTWATDPGFTKAS-----------EEERKVNIVTLAETGSLDFRTFCTSCL 432

  Fly   112 KLMPPRSWHCILCKCCILKRDRHCIFTASCVGHNNQRYFFWFTLFMAL-------GTGVALATHI 169
            ...|.||.||.:|..|:.:.|:||.:|..|:|..|..::.:|.|.:::       |:.|..:.|.
Mouse   433 IRKPLRSLHCHVCNSCVARFDQHCFWTGRCIGFGNHHHYIFFLLSLSMVCDWIIYGSFVYWSNHC 497

  Fly   170 IATLK---YFSYSDLIFLNIPRDNLPPFWLVITLILNTYVFAAPVSSVLMQL------------- 218
            ..|.|   .::|.:.|....|       |::...:|..:.|:.....::.||             
Mouse   498 ATTFKEDGLWTYLNQIVACSP-------WVLYIFMLAAFHFSWSTFLLINQLFQIAFLGLTSHER 555

  Fly   219 -SVLKNNGTLHKFYS---DTYDLGLWEN 242
             |:||.:..:.:..|   ..|:||..:|
Mouse   556 ISLLKQSRHMKQTLSLRKTPYNLGFTQN 583

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17197NP_651425.2 PHA02688 <9..70 CDD:222919 14/66 (21%)
zf-DHHC 100..>198 CDD:279823 29/121 (24%)
Zdhhc13NP_082307.1 ANK 1. /evidence=ECO:0000250|UniProtKB:Q8IUH5 43..78
ANK 79..192 CDD:238125
ANK repeat 81..112 CDD:293786
ANK 2. /evidence=ECO:0000255 81..110
Ank_2 86..179 CDD:289560
ANK repeat 114..146 CDD:293786
ANK 3. /evidence=ECO:0000255 115..144
ANK repeat 148..179 CDD:293786
ANK 4. /evidence=ECO:0000255 148..177
ANK 176..>269 CDD:238125
ANK repeat 181..247 CDD:293786
ANK 5. /evidence=ECO:0000255 181..211
Ank_5 202..257 CDD:290568
ANK 6. /evidence=ECO:0000255 216..245
ANK 7. /evidence=ECO:0000255 249..277
zf-DHHC 423..556 CDD:279823 31/139 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S11709
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.850

Return to query results.
Submit another query.