DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17197 and Zdhhc22

DIOPT Version :9

Sequence 1:NP_651425.2 Gene:CG17197 / 43111 FlyBaseID:FBgn0039367 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001074412.1 Gene:Zdhhc22 / 238331 MGIID:2685108 Length:263 Species:Mus musculus


Alignment Length:218 Identity:50/218 - (22%)
Similarity:86/218 - (39%) Gaps:55/218 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 VRISHPTAVLFVIVTTIFFVVLQMFYVVPQLFD------------VQGFMYKLGWLVAIFITYNI 72
            :|:.:..|..:.:..::...|||:|..:|.:.:            :.|.::       :|::.|.
Mouse     4 LRLLNVVAPAYFLCISLVTFVLQLFLFLPSMREDPTATPLFSPAVLHGALF-------LFLSANA 61

  Fly    73 FGNMLACHITSTSVESLPKDRQIPEPEEEHQWHYCDVCEKLM------PPRSWH-CILCKCCILK 130
            .||.:..      :::.|.|              ...|:..|      ||.|.| |.:|....|:
Mouse    62 LGNYVLV------IQNSPDD--------------LGTCQGTMSQRPQCPPPSTHFCRVCSRVTLR 106

  Fly   131 RDRHCIFTASCVGHNNQRYFFWFTLFMALG---TGVALATHIIATLKYFSYSDLIFLNIPRDNLP 192
            .|.||.||.:|:|..|.|.|..|.|:.:|.   :.||...:|.|.|.......|.||.:...::.
Mouse   107 HDHHCFFTGNCIGSRNMRNFILFCLYTSLACLYSMVAGVAYISAVLSISFAHPLAFLTLLPTSIS 171

  Fly   193 PFWLVITL------ILNTYVFAA 209
            .|:....|      ||..|::.|
Mouse   172 QFFSGAVLGSDMFVILMLYLWFA 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17197NP_651425.2 PHA02688 <9..70 CDD:222919 9/61 (15%)
zf-DHHC 100..>198 CDD:279823 31/107 (29%)
Zdhhc22NP_001074412.1 DHHC 91..218 CDD:366691 33/104 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22883
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.