DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17197 and dhhc-5

DIOPT Version :9

Sequence 1:NP_651425.2 Gene:CG17197 / 43111 FlyBaseID:FBgn0039367 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_498488.2 Gene:dhhc-5 / 187870 WormBaseID:WBGene00020066 Length:244 Species:Caenorhabditis elegans


Alignment Length:240 Identity:58/240 - (24%)
Similarity:84/240 - (35%) Gaps:70/240 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 LGWLVAIFITYNIF-------GN--------------MLACHITSTSVESLPKDRQIPEPE---E 100
            :||.:|....|.|.       |.              ::.|...|.|.....|.|.:.:.|   :
 Worm    13 IGWPIAFTFWYQIIVVLYAADGTISQWALYYFHFLWIIIVCSYFSASFTPPTKCRDVEKVEHCDK 77

  Fly   101 EHQWHYCDVCEKLMPPRSWHCILCKCCILKRDRHCIFTASCVGHNNQRYFFWFTLFMALGTGVAL 165
            |.:...|.:|....|||..||..|..|:.:.|.||.....|:...|.:||.   ||:.....:|:
 Worm    78 EIKEDVCQLCNYRKPPRWHHCRRCNLCVHRMDHHCPILQLCIHSGNHKYFL---LFLVWPLQLAI 139

  Fly   166 ATHIIATLKYFSYSDLIFLNIPRDNLPPFWLVITLILNTYVFAAP-------VSSVLM------- 216
            .|      .:..|.|             ||..|..:....:.:..       ||:.||       
 Worm   140 FT------IWHGYYD-------------FWKTIRSVYTAEILSTSEQLKGTGVSNALMVGIAALY 185

  Fly   217 ----QLSVLKNNGTL--HKFYSDTYDLGLW-ENFKLILGGKGFWT 254
                ||..|..|.||  ....:.:|:||.| ||.|.::|.   ||
 Worm   186 LLKNQLPNLMRNQTLIEESRENTSYNLGSWQENVKSVMGA---WT 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17197NP_651425.2 PHA02688 <9..70 CDD:222919 3/9 (33%)
zf-DHHC 100..>198 CDD:279823 25/97 (26%)
dhhc-5NP_498488.2 zf-DHHC 77..202 CDD:279823 36/146 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22883
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.