DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17197 and Zdhhc7

DIOPT Version :9

Sequence 1:NP_651425.2 Gene:CG17197 / 43111 FlyBaseID:FBgn0039367 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_598728.1 Gene:Zdhhc7 / 102193 MGIID:2142662 Length:308 Species:Mus musculus


Alignment Length:273 Identity:65/273 - (23%)
Similarity:118/273 - (43%) Gaps:45/273 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 IVTTIFFVVLQMFYVVPQLFDVQGFMYKLGWLVAIFITYNIFGNM-LACHITS--TSVESLPKDR 93
            ::|.:..|..........|...:.|.|.    |...:.:|....: |:.|:.:  |...::||..
Mouse    52 VMTWLLVVYADFVVTFVMLLPSKDFWYS----VVNGVLFNCLAVLALSSHLRTMLTDPGAVPKGN 112

  Fly    94 QIPEPEEEHQW------HYCDVCEKLMPPRSWHCILCKCCILKRDRHCIFTASCVGHNNQRYFFW 152
            ...|..|..|.      :.|..|..:.|.|:.||.:||.||.|.|.||.:..:|||..|||:|..
Mouse   113 ATKEYMESLQLKPGEVIYKCPKCCCIKPERAHHCSICKRCIRKMDHHCPWVNNCVGEKNQRFFVL 177

  Fly   153 FTLFMALGTGVALATHIIATLKYFS-----YSDLIFLNIPRDNLPPFWLVITLILNT-----YVF 207
            ||:::||.:..||   |:..|::.|     :::.      .|..||..:::.:.|..     :.|
Mouse   178 FTMYIALSSVHAL---ILCGLQFISCVRGQWTEC------SDFSPPITVILLVFLCLEGLLFFTF 233

  Fly   208 AAPVSSVLMQLSVLKNNGTLHKFYSD--TYDLGL-WENFKLILGGKGFWTFLSPTVKSPLPHDGA 269
            .|.:....:. |:..:...:.:..|:  |::..| ||..|.:.||.....:::|.|         
Mouse   234 TAVMFGTQIH-SICNDETEIERLKSEKPTWERRLRWEGMKSVFGGPPSLLWMNPFV--------- 288

  Fly   270 QWKIKRVQHHSPK 282
            .::::|:|..:.|
Mouse   289 GFRLRRLQMRTRK 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17197NP_651425.2 PHA02688 <9..70 CDD:222919 6/37 (16%)
zf-DHHC 100..>198 CDD:279823 35/108 (32%)
Zdhhc7NP_598728.1 DHHC 131..258 CDD:366691 37/136 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.