DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17197 and zdhhc14

DIOPT Version :9

Sequence 1:NP_651425.2 Gene:CG17197 / 43111 FlyBaseID:FBgn0039367 Length:290 Species:Drosophila melanogaster
Sequence 2:XP_004914695.1 Gene:zdhhc14 / 100489334 XenbaseID:XB-GENE-998053 Length:481 Species:Xenopus tropicalis


Alignment Length:296 Identity:69/296 - (23%)
Similarity:113/296 - (38%) Gaps:91/296 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 VLFVIVTTIFFVVLQMFYVVPQLFDVQGFMYKLGWLVAIFIT--YNIFGNMLACHITSTSVES-- 88
            |:....|.:|::.|.:..|...||    |.:...:| |:.||  ..:.|.:|...:..|.:.:  
 Frog    47 VMMARQTGVFYLTLILILVTSGLF----FAFDCPYL-AVKITPAIPVIGGILVFFVMGTLLRTSF 106

  Fly    89 -----LPK---------DRQI------------PEPEEEH--------QWHYCDVCEKLMPPRSW 119
                 ||:         :|||            |.|..:.        :..||..|:...|||:.
 Frog   107 SDPGVLPRATPDEAADLERQIDVANGSTSGGYRPPPRTKEVVINGQTVKLKYCFTCKIFRPPRAS 171

  Fly   120 HCILCKCCILKRDRHCIFTASCVGHNNQRYFFWFTLFMALGTGVALA---THIIATLKYFSYSDL 181
            ||.||..|:.:.|.||.:..:|||..|.|:|:.|.|.::..|....|   ||:|...:...    
 Frog   172 HCSLCDNCVERFDHHCPWVGNCVGKRNYRFFYMFILSLSFLTVFIFAFVITHVILRSQQSG---- 232

  Fly   182 IFLNIPRDNLPPFWLVITLILNTYVFAAPVSSVLMQLSVLKNNGTLHKFYSDTYDLGLWENFKLI 246
             |||..:|:  |              |:.:.:|:...||                   |.    |
 Frog   233 -FLNALKDS--P--------------ASVLEAVVCFFSV-------------------WS----I 257

  Fly   247 LGGKGFWTFLSPTVKSPLPHDGAQWKIKR-VQHHSP 281
            :|..||.|:|..:.::........|..|| .::::|
 Frog   258 VGLSGFHTYLISSNQTTNEDIKGSWSSKRGKENYNP 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17197NP_651425.2 PHA02688 <9..70 CDD:222919 12/43 (28%)
zf-DHHC 100..>198 CDD:279823 32/108 (30%)
zdhhc14XP_004914695.1 DHHC 156..279 CDD:366691 43/166 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.