Sequence 1: | NP_651425.2 | Gene: | CG17197 / 43111 | FlyBaseID: | FBgn0039367 | Length: | 290 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001123690.1 | Gene: | slc66a1l / 100170445 | XenbaseID: | XB-GENE-5794175 | Length: | 303 | Species: | Xenopus tropicalis |
Alignment Length: | 262 | Identity: | 57/262 - (21%) |
---|---|---|---|
Similarity: | 81/262 - (30%) | Gaps: | 90/262 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 86 VESLPKDRQIPEPEEEHQWHYCDVCEKLMPPRSWHCILCKCCILKRDRHCIFTA---SCVGHNNQ 147
Fly 148 R---------YFFW----FTLFMALGTGVALATHIIATLKY----------FSYSDL-------- 181
Fly 182 ----------IFLNIPRDNLPPFWLVITLILNTYVFAAPVSSVLMQLSVLKNNGTLHKFYSDTYD 236
Fly 237 LG-----LWENFK--------------LILGGKGFWTFLSPTVKSP-LPHDGAQWKIKRVQHHSP 281
Fly 282 KL 283 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17197 | NP_651425.2 | PHA02688 | <9..70 | CDD:222919 | |
zf-DHHC | 100..>198 | CDD:279823 | 30/141 (21%) | ||
slc66a1l | NP_001123690.1 | PQ-loop | 44..103 | CDD:282099 | 16/74 (22%) |
PQ-loop | 185..238 | CDD:282099 | 11/54 (20%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |