DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17197 and pigv

DIOPT Version :9

Sequence 1:NP_651425.2 Gene:CG17197 / 43111 FlyBaseID:FBgn0039367 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001186989.1 Gene:pigv / 100148642 ZFINID:ZDB-GENE-121116-1 Length:523 Species:Danio rerio


Alignment Length:175 Identity:38/175 - (21%)
Similarity:53/175 - (30%) Gaps:78/175 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 NPKIFVRISHPTAVLFVIVTTIFFVVLQMFYV--VPQLFDVQG---FMYKLGWLVAIFITYNIFG 74
            ||::||.|.|.|.:|...:..:...||..|..  .|.|:.|.|   |.|                
Zfish   399 NPRVFVYIVHNTVLLLFGIFCMHVQVLTRFLASSSPVLYWVSGHLLFKY---------------- 447

  Fly    75 NMLACHITSTSVESLPKDRQIPEPEEEHQ--------------WHYCDVCEKLMPPRSWHCILCK 125
                        |.|.|:.::...::..|              |....|...||   .|     |
Zfish   448 ------------EPLLKEEKLFRSDQTQQKKNHKPGLRCFAGMWRNNPVFYLLM---HW-----K 492

  Fly   126 CCILKRDRHCIFTASCVGHNNQRYF--FWFTLFMALGTGVALATH 168
            .|       .|:|...:|     ||  :||         :.||.|
Zfish   493 TC-------SIYTQCILG-----YFISYWF---------LGLALH 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17197NP_651425.2 PHA02688 <9..70 CDD:222919 17/59 (29%)
zf-DHHC 100..>198 CDD:279823 18/85 (21%)
pigvNP_001186989.1 PMT_2 23..523 CDD:304453 38/175 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.